ZNF30 (zinc finger protein 30)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 90075
Gene name Zinc finger protein 30
Gene symbol ZNF30
Synonyms (NCBI Gene)
KOX28
Chromosome 19
Chromosome location 19q13.11
miRNA miRNA information provided by mirtarbase database.
3
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT016106 hsa-miR-421 Sequencing 20371350
MIRT2157466 hsa-miR-4718 CLIP-seq
MIRT2377077 hsa-miR-188-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P17039
Protein name Zinc finger protein 30 (Zinc finger protein KOX28)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 596 → 618 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 288 → 310 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 428 → 450 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 484 → 506 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 400 → 422 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 316 → 338 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 512 → 534 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 260 → 282 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 372 → 394 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 568 → 590 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 344 → 366 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 456 → 478 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 149 → 170 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 540 → 562 Zinc finger, C2H2 type Domain
PF01352 KRAB 13 → 54 KRAB box Family
Sequence 
MAHKYVGLQYHGSVTFEDVAIAFSQQEWESLDSSQRGLYRDVMLENYRNLVSMGHSRSKP
HVIALLEQWKEPEVTVRKDGRRWCTDLQLEDDTIGCKEMPTSENCPSFALHQKISRQKPR
ECQEYGKTLCQDSKPVQHERIHSSEKPNRCKECGKNFSNGHQLTIHQRLHVGEKPYKYEK
CGKAFISGSAFVKHGRIHTGEKPLKCKQCGKTISGSYQLTVHKSIHTGKKPYECGECGKA
FLVYGKLTRHQSTHTGEKPFGCEECGKAFSTFSYLVQHQRIHTSEKPYECKECGKAFSTS
SPLAKHQRIHTGEKPYECKECGKSFTVYGQLTRHQSIHTGEKPFECKECGKAFRLSSFLH
AHQRIHAEIKPYGCKECGRTFSRASYLVQHGRLHTGEKPYECKECGKAFSTGSYLVQHQR
IHTGEKPYECKECGKAFISRHQLTVHQRVHTGEKPYECKECGKAFRVHVHLTQHRKIHTD
VKPYECKECGKTFSRASYLVQHSRIHTGKKPYECKECGKAFSSGSYLVQHQRIHTGEKPY
ECNKCGKAFTVYGQLIGHQSVHTGEKPFECKECGKAFRLNSFLTEHQRVHTGEKPFKCKK
CGKTFRYSSALKVHLRKHMSVIP
Sequence length 623
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Generic Transcription Pathway

No strongly related genes found yet for ZNF30.

No additional diseases found yet through genes similar to ZNF30.