ZNF264 (zinc finger protein 264)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 9422
Gene name Zinc finger protein 264
Gene symbol ZNF264
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19q13.43
Summary This gene encodes a zinc finger protein and belongs to the krueppel C2H2-type zinc-finger protein family. Zinc finger proteins are often localized in the nucleus, bind nucleic acids, and regulate transcription. [provided by RefSeq, Jan 2010]
miRNA miRNA information provided by mirtarbase database.
2340 Show/Hide all (2340)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT020176 hsa-miR-130b-3p Sequencing 20371350
MIRT023326 hsa-miR-122-5p Microarray 17612493
MIRT002733 hsa-miR-1-3p Microarray 18668037
MIRT002733 hsa-miR-1-3p Microarray 15685193
MIRT025782 hsa-miR-7-5p Microarray 17612493
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 28514442, 32296183, 33961781
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
604668 13057 ENSG00000083844
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43296
Protein name Zinc finger protein 264
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 539 → 561 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 259 → 281 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 399 → 421 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 343 → 365 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 483 → 505 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 455 → 477 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 287 → 309 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 203 → 225 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 231 → 253 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 427 → 449 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 511 → 533 Zinc finger, C2H2 type Domain
PF01352 KRAB 13 → 54 KRAB box Family
Tissue specificity TISSUE SPECIFICITY: Relatively highly expressed in kidney, thymus, testis, ovary, brain, lung, placenta, and prostate, and relatively low expression in heart, liver, skeletal muscle, pancreas, spleen, and small intestine.
Sequence 
MAAAVLTDRAQVSVTFDDVAVTFTKEEWGQLDLAQRTLYQEVMLENCGLLVSLGCPVPKA
ELICHLEHGQEPWTRKEDLSQDTCPGDKGKPKTTEPTTCEPALSEGISLQGQVTQGNSVD
SQLGQAEDQDGLSEMQEGHFRPGIDPQEKSPGKMSPECDGLGTADGVCSRIGQEQVSPGD
RVRSHNSCESGKDPMIQEEENNFKCSECGKVFNKKHLLAGHEKIHSGVKPYECTECGKTF
IKSTHLLQHHMIHTGERPYECMECGKAFNRKSYLTQHQRIHSGEKPYKCNECGKAFTHRS
NFVLHNRRHTGEKSFVCTECGQVFRHRPGFLRHYVVHSGENPYECLECGKVFKHRSYLMW
HQQTHTGEKPYECSECGKVFLESAALIHHYVIHTGEKPFECLECGKAFNHRSYLKRHQRI
HTGEKPFVCSECGKAFTHCSTFILHKRAHTGEKPFECKECGKAFSNRKDLIRHFSIHTGE
KPYECVECGKAFTRMSGLTRHKRIHSGEKPYECVECGKSFCWSTNLIRHAIIHTGEKPYK
CSECGKAFSRSSSLTQHQRMHTGKNPISVTDVGRPFTSGQTSVTLRELLLGKDFLNVTTE
ANILPEETSSSASDQPYQRETPQVSSL
Sequence length 627
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
ZNF264-related disorder Likely benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations

No strongly related genes found yet for ZNF264.

No additional diseases found yet through genes similar to ZNF264.