ZNF263 (zinc finger protein 263)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 10127
• Gene name: Zinc finger protein 263
• Gene symbol: ZNF263
• Synonyms (NCBI Gene): FPM315, ZKSCAN12, ZSCAN44
• Chromosome: 16
• Chromosome location: 16p13.3

miRNA Show/Hide all (99)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026455	hsa-miR-192-5p	Sequencing	20371350
MIRT040352	hsa-miR-615-3p	CLASH	23622248
MIRT1519786	hsa-miR-1	CLIP-seq
MIRT1519787	hsa-miR-1258	CLIP-seq
MIRT1519788	hsa-miR-1295	CLIP-seq
MIRT1519789	hsa-miR-1324	CLIP-seq
MIRT1519790	hsa-miR-133a	CLIP-seq
MIRT1519791	hsa-miR-133b	CLIP-seq
MIRT1519792	hsa-miR-1343	CLIP-seq
MIRT1519793	hsa-miR-1587	CLIP-seq
MIRT1519794	hsa-miR-206	CLIP-seq
MIRT1519795	hsa-miR-216a	CLIP-seq
MIRT1519796	hsa-miR-216b	CLIP-seq
MIRT1519797	hsa-miR-2467-3p	CLIP-seq
MIRT1519798	hsa-miR-3074-5p	CLIP-seq
MIRT1519799	hsa-miR-3124-3p	CLIP-seq
MIRT1519800	hsa-miR-3185	CLIP-seq
MIRT1519801	hsa-miR-3613-3p	CLIP-seq
MIRT1519802	hsa-miR-361-5p	CLIP-seq
MIRT1519803	hsa-miR-3673	CLIP-seq
MIRT1519804	hsa-miR-3678-3p	CLIP-seq
MIRT1519805	hsa-miR-3690	CLIP-seq
MIRT1519806	hsa-miR-378g	CLIP-seq
MIRT1519807	hsa-miR-3915	CLIP-seq
MIRT1519808	hsa-miR-3928	CLIP-seq
MIRT1519809	hsa-miR-4254	CLIP-seq
MIRT1519810	hsa-miR-4257	CLIP-seq
MIRT1519811	hsa-miR-4328	CLIP-seq
MIRT1519812	hsa-miR-4436b-3p	CLIP-seq
MIRT1519813	hsa-miR-4492	CLIP-seq
MIRT1519814	hsa-miR-4498	CLIP-seq
MIRT1519815	hsa-miR-4529-5p	CLIP-seq
MIRT1519816	hsa-miR-4633-5p	CLIP-seq
MIRT1519817	hsa-miR-4656	CLIP-seq
MIRT1519818	hsa-miR-4675	CLIP-seq
MIRT1519819	hsa-miR-4717-5p	CLIP-seq
MIRT1519820	hsa-miR-4727-5p	CLIP-seq
MIRT1519821	hsa-miR-4741	CLIP-seq
MIRT1519822	hsa-miR-4753-3p	CLIP-seq
MIRT1519823	hsa-miR-4761-3p	CLIP-seq
MIRT1519824	hsa-miR-4769-3p	CLIP-seq
MIRT1519825	hsa-miR-483-3p	CLIP-seq
MIRT1519826	hsa-miR-491-3p	CLIP-seq
MIRT1519827	hsa-miR-515-5p	CLIP-seq
MIRT1519828	hsa-miR-579	CLIP-seq
MIRT1519829	hsa-miR-613	CLIP-seq
MIRT1519830	hsa-miR-762	CLIP-seq
MIRT1519831	hsa-miR-885-5p	CLIP-seq
MIRT2156850	hsa-miR-1231	CLIP-seq
MIRT2156851	hsa-miR-125a-3p	CLIP-seq
MIRT2156852	hsa-miR-1279	CLIP-seq
MIRT1519789	hsa-miR-1324	CLIP-seq
MIRT2156853	hsa-miR-3130-3p	CLIP-seq
MIRT1519802	hsa-miR-361-5p	CLIP-seq
MIRT2156854	hsa-miR-3654	CLIP-seq
MIRT2156855	hsa-miR-3934	CLIP-seq
MIRT2156856	hsa-miR-4288	CLIP-seq
MIRT2156857	hsa-miR-4469	CLIP-seq
MIRT2156858	hsa-miR-4520a-3p	CLIP-seq
MIRT2156859	hsa-miR-4638-3p	CLIP-seq
MIRT2156860	hsa-miR-4649-3p	CLIP-seq
MIRT2156861	hsa-miR-4666-5p	CLIP-seq
MIRT2156862	hsa-miR-4699-3p	CLIP-seq
MIRT1519820	hsa-miR-4727-5p	CLIP-seq
MIRT1519824	hsa-miR-4769-3p	CLIP-seq
MIRT2156863	hsa-miR-4793-3p	CLIP-seq
MIRT2156864	hsa-miR-548ag	CLIP-seq
MIRT2156865	hsa-miR-548ai	CLIP-seq
MIRT2156866	hsa-miR-548g	CLIP-seq
MIRT2156867	hsa-miR-632	CLIP-seq
MIRT2156868	hsa-miR-764	CLIP-seq
MIRT2376506	hsa-miR-1305	CLIP-seq
MIRT1519789	hsa-miR-1324	CLIP-seq
MIRT1519795	hsa-miR-216a	CLIP-seq
MIRT1519802	hsa-miR-361-5p	CLIP-seq
MIRT2376507	hsa-miR-377	CLIP-seq
MIRT2376508	hsa-miR-4447	CLIP-seq
MIRT2376509	hsa-miR-4472	CLIP-seq
MIRT1519820	hsa-miR-4727-5p	CLIP-seq
MIRT1519824	hsa-miR-4769-3p	CLIP-seq
MIRT1519827	hsa-miR-515-5p	CLIP-seq
MIRT2376510	hsa-miR-552	CLIP-seq
MIRT2376511	hsa-miR-625	CLIP-seq
MIRT2376512	hsa-miR-873	CLIP-seq
MIRT2435022	hsa-miR-125a-5p	CLIP-seq
MIRT2435023	hsa-miR-125b	CLIP-seq
MIRT2435024	hsa-miR-3123	CLIP-seq
MIRT2435025	hsa-miR-3620	CLIP-seq
MIRT2435026	hsa-miR-3919	CLIP-seq
MIRT2435027	hsa-miR-4319	CLIP-seq
MIRT2435028	hsa-miR-544b	CLIP-seq
MIRT1519797	hsa-miR-2467-3p	CLIP-seq
MIRT1519800	hsa-miR-3185	CLIP-seq
MIRT1519804	hsa-miR-3678-3p	CLIP-seq
MIRT1519810	hsa-miR-4257	CLIP-seq
MIRT1519797	hsa-miR-2467-3p	CLIP-seq
MIRT1519800	hsa-miR-3185	CLIP-seq
MIRT1519804	hsa-miR-3678-3p	CLIP-seq
MIRT1519810	hsa-miR-4257	CLIP-seq

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	19887448, 32051553
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	32277030
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	32051553, 32277030
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	19887448
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9256059
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 28514442, 32051553, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	32051553
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	9256059
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	28473536
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	26089202
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

Other IDs

• MIM: 604191
• HGNC: 13056
• e!Ensembl: ENSG00000006194

Protein

• UniProt ID: O14978
• Protein name: Zinc finger protein 263 (Zinc finger protein FPM315) (Zinc finger protein with KRAB and SCAN domains 12)
• Protein function: Transcription factor that binds to the consensus sequence 5'-TCCTCCC-3' and acts as a transcriptional repressor (PubMed:32051553). Binds to the promoter region of SIX3 and recruits other proteins involved in chromatin modification and transcript
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	518 → 540	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	490 → 512	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	659 → 681	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	378 → 400	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	603 → 625	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	434 → 456	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	575 → 597	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	462 → 484	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	631 → 653	Zinc finger, C2H2 type	Domain
  PF01352	KRAB	218 → 257	KRAB box	Family
  PF02023	SCAN	37 → 125	SCAN domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocyte. {ECO:0000269|PubMed:9256059}.
• Sequence:

  MASGPGSQEREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALS
  RLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
  RELGRLRQQVTNHGRGTEVLLEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPSPQ
  RDPQAVKERALSAPWLSLFPPEGNMEDKEMTGPQLPESLEDVAMYISQEEWGHQDPSKRA
  LSRDTVQESYENVDSLESHIPSQEVPGTQVGQGGKLWDPSVQSCKEGLSPRGPAPGEEKF
  ENLEGVPSVCSENIHPQVLLPDQARGEVPWSPELGRPHDRSQGDWAPPPEGGMEQALAGA
  SSGRELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVDCTEIFGGNPR
  FLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKCFSCNSNLHRH
  QRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLVIHERTH
  ERERLYPFSECGEAVSDSTPFLTNHGAHKAEKKLFECLTCGKSFRQGMHLTRHQRTHTGE
  KPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYK
  CSECGESFSRSSRLMSHQRTHTG

• Sequence length: 683

Pathways

Reactome Pathway:

Generic Transcription Pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	38374256	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (10)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arteriosclerosis	Arteriosclerosis	BEFREE	24819318		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24819318		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24819318	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27458175	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34514002, 36035369	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	39294234	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32051553	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31537905	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	39294234	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37065635	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for ZNF263.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ZNF263.