Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	7767
Gene name	Zinc finger protein 224
Gene symbol	ZNF224
Synonyms (NCBI Gene)	BMZF-2BMZF2KOX22ZNF233ZNF255ZNF27
Chromosome	19
Chromosome location	19q13.31
Summary	This gene encodes a member of the Krueppel C2H2-type zinc-finger family of proteins. The encoded protein represses transcription of the aldolase A gene, which encodes a key enzyme in glycolysis. The encoded zinc-finger protein may also function as a trans

87 Show/Hide all (87)

miRTarBase ID	miRNA	Experiments	Reference
MIRT718172	hsa-miR-6512-5p	HITS-CLIP	19536157
MIRT718171	hsa-miR-3913-3p	HITS-CLIP	19536157
MIRT718170	hsa-miR-4520-3p	HITS-CLIP	19536157
MIRT718169	hsa-miR-4520-2-3p	HITS-CLIP	19536157
MIRT718168	hsa-miR-4529-3p	HITS-CLIP	19536157
MIRT718167	hsa-miR-7850-5p	HITS-CLIP	19536157
MIRT544701	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT544700	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT544699	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT544696	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT544695	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT544694	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT544693	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT544691	hsa-miR-3666	PAR-CLIP	20371350
MIRT544692	hsa-miR-4295	PAR-CLIP	20371350
MIRT544690	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT544689	hsa-miR-3163	PAR-CLIP	20371350
MIRT544688	hsa-miR-95-5p	PAR-CLIP	20371350
MIRT544687	hsa-miR-665	PAR-CLIP	20371350
MIRT544685	hsa-miR-4786-3p	PAR-CLIP	20371350
MIRT544686	hsa-miR-4480	PAR-CLIP	20371350
MIRT544684	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT544683	hsa-miR-505-5p	PAR-CLIP	20371350
MIRT544701	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT544700	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT544699	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT544698	hsa-miR-409-3p	PAR-CLIP	21572407
MIRT544697	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT544696	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT544695	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT544694	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT544693	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT544691	hsa-miR-3666	PAR-CLIP	21572407
MIRT544692	hsa-miR-4295	PAR-CLIP	21572407
MIRT544690	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT544689	hsa-miR-3163	PAR-CLIP	21572407
MIRT544688	hsa-miR-95-5p	PAR-CLIP	21572407
MIRT544687	hsa-miR-665	PAR-CLIP	21572407
MIRT544685	hsa-miR-4786-3p	PAR-CLIP	21572407
MIRT544686	hsa-miR-4480	PAR-CLIP	21572407
MIRT544684	hsa-miR-671-5p	PAR-CLIP	21572407
MIRT544683	hsa-miR-505-5p	PAR-CLIP	21572407
MIRT726044	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT726042	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT726043	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT718172	hsa-miR-6512-5p	HITS-CLIP	19536157
MIRT718171	hsa-miR-3913-3p	HITS-CLIP	19536157
MIRT718170	hsa-miR-4520-3p	HITS-CLIP	19536157
MIRT718169	hsa-miR-4520-2-3p	HITS-CLIP	19536157
MIRT718168	hsa-miR-4529-3p	HITS-CLIP	19536157
MIRT718167	hsa-miR-7850-5p	HITS-CLIP	19536157
MIRT544701	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT544700	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT544699	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT544696	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT544695	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT544694	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT544693	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT544691	hsa-miR-3666	PAR-CLIP	20371350
MIRT544692	hsa-miR-4295	PAR-CLIP	20371350
MIRT544690	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT544689	hsa-miR-3163	PAR-CLIP	20371350
MIRT544688	hsa-miR-95-5p	PAR-CLIP	20371350
MIRT544687	hsa-miR-665	PAR-CLIP	20371350
MIRT544685	hsa-miR-4786-3p	PAR-CLIP	20371350
MIRT544686	hsa-miR-4480	PAR-CLIP	20371350
MIRT544684	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT544683	hsa-miR-505-5p	PAR-CLIP	20371350
MIRT544701	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT544700	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT544699	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT544698	hsa-miR-409-3p	PAR-CLIP	21572407
MIRT544697	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT544696	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT544695	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT544694	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT544693	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT544691	hsa-miR-3666	PAR-CLIP	21572407
MIRT544692	hsa-miR-4295	PAR-CLIP	21572407
MIRT544690	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT544689	hsa-miR-3163	PAR-CLIP	21572407
MIRT544688	hsa-miR-95-5p	PAR-CLIP	21572407
MIRT544687	hsa-miR-665	PAR-CLIP	21572407
MIRT544685	hsa-miR-4786-3p	PAR-CLIP	21572407
MIRT544686	hsa-miR-4480	PAR-CLIP	21572407
MIRT544684	hsa-miR-671-5p	PAR-CLIP	21572407
MIRT544683	hsa-miR-505-5p	PAR-CLIP	21572407

19 Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12527367
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	12527367
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	20587513, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	20587513, 23665872
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0017053	Component	Transcription repressor complex	IDA	20587513
GO:0031965	Component	Nuclear membrane	IDA
GO:0043565	Function	Sequence-specific DNA binding	IDA	12527367
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	20587513
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
194555	13017	ENSG00000267680

Q9NZL3

Protein name

Zinc finger protein 224 (Bone marrow zinc finger 2) (BMZF-2) (Zinc finger protein 233) (Zinc finger protein 255) (Zinc finger protein 27) (Zinc finger protein KOX22)

Protein function

May be involved in transcriptional regulation as a transcriptional repressor. The DEPDC1A-ZNF224 complex may play a critical role in bladder carcinogenesis by repressing the transcription of the A20 gene, leading to transport of NF-KB protein in

PDB

2ELY , 2ELZ , 2EM0 , 2EM6 , 2EM7 , 2EM8 , 2EM9 , 2EN1 , 2EN8 , 2ENA , 2ENC , 2EOQ , 2EOR , 2EQ4 , 2YSP , 2YTH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	204 → 226	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	568 → 590	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	484 → 506	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	316 → 338	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	232 → 254	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	260 → 282	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	456 → 478	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	652 → 674	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	680 → 702	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	176 → 198	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	512 → 534	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	372 → 394	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	288 → 310	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	540 → 562	Zinc finger, C2H2 type	Domain
PF01352	KRAB	7 → 48	KRAB box	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Mainly expressed in fetal tissues. {ECO:0000269|PubMed:12239212}.

Sequence

MTTFKEAMTFKDVAVVFTEEELGLLDLAQRKLYRDVMLENFRNLLSVGHQAFHRDTFHFL
REEKIWMMKTAIQREGNSGDKIQTEMETVSEAGTHQEWSFQQIWEKIASDLTRSQDLMIN
SSQFSKEGDFPCQTEAGLSVIHTRQKSSQGNGYKPSFSDVSHFDFHQQLHSGEKSHTCDE
CGKNFCYISALRIHQRVHMGEKCYKCDVCGKEFSQSSHLQTHQRVHTGEKPFKCVECGKG
FSRRSALNVHHKLHTGEKPYNCEECGKAFIHDSQLQEHQRIHTGEKPFKCDICGKSFCGR
SRLNRHSMVHTAEKPFRCDTCDKSFRQRSALNSHRMIHTGEKPYKCEECGKGFICRRDLY
THHMVHTGEKPYNCKECGKSFRWASCLLKHQRVHSGEKPFKCEECGKGFYTNSQCYSHQR
SHSGEKPYKCVECGKGYKRRLDLDFHQRVHTGEKLYNCKECGKSFSRAPCLLKHERLHSG
EKPFQCEECGKRFTQNSHLHSHQRVHTGEKPYKCEKCGKGYNSKFNLDMHQKVHTGERPY
NCKECGKSFGWASCLLKHQRLHSGEKPFKCEECGKRFTQNSQLHSHQRVHTGEKPYKCDE
CGKGFSWSSTRLTHQRRHSRETPLKCEQHGKNIVQNSFSKVQEKVHSVEKPYKCEDCGKG
YNRRLNLDMHQRVHMGEKTWKCRECDMCFSQASSLRLHQNVHVGEKP

Sequence length

707

Interactions

View interactions

Reactome Pathway
Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (20)
Alzheimer Disease	Alzheimer disease	Pubtator	20574532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	21152065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	20587513, 29963168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27105517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27105517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	20587513, 29963168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28040726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	20574532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	27105517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	20574532		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	28040726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27105517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29963168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	20587513, 29963168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27105517, 28215224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19544972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24374813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	26320177, 29423056, 30176265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28215224, 30176265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	12239212		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with ZNF224 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for ZNF224.

Diseases Linked via Similar Genes Diseases curated for genes most similar to ZNF224 (see Related Genes above), that are NOT already directly curated for ZNF224 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to ZNF224.

ZNF224 (zinc finger protein 224)

Bookmark This Gene