ZNF214 (zinc finger protein 214)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 7761
Gene name Zinc finger protein 214
Gene symbol ZNF214
Synonyms (NCBI Gene)
BAZ-1BAZ1
Chromosome 11
Chromosome location 11p15.4
Summary This gene is expressed predominantly in the testis and encodes a zinc finger protein that contains an N-terminal kruppel-associated box A (KRABA) domain and twelve zinc finger domains. This gene is located within one of three regions on chromosome 11p15 a
miRNA miRNA information provided by mirtarbase database.
6 Show/Hide all (6)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT045263 hsa-miR-186-5p CLASH 23622248
MIRT2375975 hsa-miR-2909 CLIP-seq
MIRT2375976 hsa-miR-3647-3p CLIP-seq
MIRT2375977 hsa-miR-4278 CLIP-seq
MIRT2375978 hsa-miR-4424 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity NAS 34673265
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of DNA-templated transcription IEA
GO:0008270 Function Zinc ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
605015 13006 ENSG00000149050
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UL59
Protein name Zinc finger protein 214 (BWSCR2-associated zinc finger protein 1) (BAZ-1)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 414 → 436 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 442 → 464 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 386 → 408 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 498 → 520 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 526 → 548 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 554 → 576 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 358 → 380 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 470 → 492 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 303 → 325 Zinc finger, C2H2 type Domain
PF01352 KRAB 2 → 43 KRAB box Family
Sequence 
MAVTFEDVTIIFTWEEWKFLDSSQKRLYREVMWENYTNVMSVENWNESYKSQEEKFRYLE
YENFSYWQGWWNAGAQMYENQNYGETVQGTDSKDLTQQDRSQCQEWLILSTQVPGYGNYE
LTFESKSLRNLKYKNFMPWQSLETKTTQDYGREIYMSGSHGFQGGRYRLGISRKNLSMEK
EQKLIVQHSYIPVEEALPQYVGVICQEDLLRDSMEEKYCGCNKCKGIYYWNSRCVFHKRN
QPGENLCQCSICKACFSQRSDLYRHPRNHIGKKLYGCDEVDGNFHQSSGVHFHQRVHIGE
VPYSCNACGKSFSQISSLHNHQRVHTEEKFYKIECDKDLSRNSLLHIHQRLHIGEKPFKC
NQCGKSFNRSSVLHVHQRVHTGEKPYKCDECGKGFSQSSNLRIHQLVHTGEKSYKCEDCG
KGFTQRSNLQIHQRVHTGEKPYKCDDCGKDFSHSSDLRIHQRVHTGEKPYTCPECGKGFS
KSSKLHTHQRVHTGEKPYKCEECGKGFSQRSHLLIHQRVHTGEKPYKCHDCGKGFSHSSN
LHIHQRVHTGEKPYQCAKCGKGFSHSSALRIHQRVHAGEKPYKCREYYKGFDHNSHLHNN
HRRGNL
Sequence length 606
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Generic Transcription Pathway

No strongly related genes found yet for ZNF214.

No additional diseases found yet through genes similar to ZNF214.