ZNF16 (zinc finger protein 16)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7564
• Gene name: Zinc finger protein 16
• Gene symbol: ZNF16
• Synonyms (NCBI Gene): HZF1, KOX9
• Chromosome: 8
• Chromosome location: 8q24.3
• Summary: The protein encoded by this gene contains multiple tandem zinc finger motifs. The encoded protein is involved in the differentiation of erythroid and megakaryocytic cells. This gene is located in a cluster of related genes on chromosome 8 encoding zinc fi

miRNA Show/Hide all (48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1517021	hsa-miR-1265	CLIP-seq
MIRT1517022	hsa-miR-1915	CLIP-seq
MIRT1517023	hsa-miR-299-3p	CLIP-seq
MIRT1517024	hsa-miR-3173-3p	CLIP-seq
MIRT1517025	hsa-miR-3607-3p	CLIP-seq
MIRT1517026	hsa-miR-4491	CLIP-seq
MIRT1517027	hsa-miR-4657	CLIP-seq
MIRT1517028	hsa-miR-4726-3p	CLIP-seq
MIRT1517029	hsa-miR-4779	CLIP-seq
MIRT1517030	hsa-miR-607	CLIP-seq
MIRT1517031	hsa-miR-663b	CLIP-seq
MIRT2156110	hsa-miR-4528	CLIP-seq
MIRT2397436	hsa-miR-194	CLIP-seq
MIRT2397437	hsa-miR-4287	CLIP-seq
MIRT2397438	hsa-miR-4469	CLIP-seq
MIRT2397439	hsa-miR-4685-3p	CLIP-seq
MIRT2397440	hsa-miR-4713-5p	CLIP-seq
MIRT2397441	hsa-miR-4780	CLIP-seq
MIRT2397442	hsa-miR-495	CLIP-seq
MIRT2397443	hsa-miR-623	CLIP-seq
MIRT2397444	hsa-miR-942	CLIP-seq
MIRT2668062	hsa-miR-1270	CLIP-seq
MIRT2668063	hsa-miR-185	CLIP-seq
MIRT2668064	hsa-miR-3125	CLIP-seq
MIRT2668065	hsa-miR-3916	CLIP-seq
MIRT2668066	hsa-miR-3926	CLIP-seq
MIRT2668067	hsa-miR-423-3p	CLIP-seq
MIRT2668068	hsa-miR-4306	CLIP-seq
MIRT2668069	hsa-miR-4496	CLIP-seq
MIRT2668070	hsa-miR-4531	CLIP-seq
MIRT2668071	hsa-miR-4644	CLIP-seq
MIRT2668072	hsa-miR-548s	CLIP-seq
MIRT2668073	hsa-miR-571	CLIP-seq
MIRT2668074	hsa-miR-583	CLIP-seq
MIRT2668075	hsa-miR-620	CLIP-seq
MIRT2668062	hsa-miR-1270	CLIP-seq
MIRT2668063	hsa-miR-185	CLIP-seq
MIRT2668064	hsa-miR-3125	CLIP-seq
MIRT2668065	hsa-miR-3916	CLIP-seq
MIRT2668066	hsa-miR-3926	CLIP-seq
MIRT2668068	hsa-miR-4306	CLIP-seq
MIRT2668069	hsa-miR-4496	CLIP-seq
MIRT2668070	hsa-miR-4531	CLIP-seq
MIRT2668071	hsa-miR-4644	CLIP-seq
MIRT2668072	hsa-miR-548s	CLIP-seq
MIRT2668073	hsa-miR-571	CLIP-seq
MIRT2668074	hsa-miR-583	CLIP-seq
MIRT2668075	hsa-miR-620	CLIP-seq

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	21874239, 25416956, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16628192
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	21874239
GO:0009893	Process	Positive regulation of metabolic process	IEA
GO:0033674	Process	Positive regulation of kinase activity	IDA	21874239
GO:0043066	Process	Negative regulation of apoptotic process	IDA	21874239
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IMP	16628192
GO:0045654	Process	Positive regulation of megakaryocyte differentiation	IMP	16628192
GO:0046872	Function	Metal ion binding	IEA
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0051301	Process	Cell division	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0072707	Process	Cellular response to sodium dodecyl sulfate	IDA	21874239
GO:1901989	Process	Positive regulation of cell cycle phase transition	IDA	21874239

Other IDs

• MIM: 601262
• HGNC: 12947
• e!Ensembl: ENSG00000170631

Protein

• UniProt ID: P17020
• Protein name: Zinc finger protein 16 (Zinc finger protein KOX9)
• Protein function: Acts as a transcriptional activator. Promotes cell proliferation by facilitating the cell cycle phase transition from the S to G2/M phase. Involved in both the hemin- and phorbol myristate acetate (PMA)-induced erythroid and megakaryocytic diffe
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	321 → 343	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	349 → 371	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	405 → 427	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	433 → 455	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	377 → 399	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	545 → 567	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	293 → 315	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	517 → 539	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	573 → 595	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	601 → 623	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	629 → 651	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	489 → 511	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	461 → 483	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	657 → 679	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	265 → 287	Zinc finger, C2H2 type	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16628192}.
• Sequence:

  MPSLRTRREEAEMELSVPGPSPWTPAAQARVRDAPAVTHPGSAACGTPCCSDTELEAICP
  HYQQPDCDTRTEDKEFLHKEDIHEDLESQAEISENYAGDVSQVPELGDLCDDVSERDWGV
  PEGRRLPQSLSQEGDFTPAAMGLLRGPLGEKDLDCNGFDSRFSLSPNLMACQEIPTEERP
  HPYDMGGQSFQHSVDLTGHEGVPTAESPLICNECGKTFQGNPDLIQRQIVHTGEASFMCD
  DCGKTFSQNSVLKNRHRSHMSEKAYQCSECGKAFRGHSDFSRHQSHHSSERPYMCNECGK
  AFSQNSSLKKHQKSHMSEKPYECNECGKAFRRSSNLIQHQRIHSGEKPYVCSECGKAFRR
  SSNLIKHHRTHTGEKPFECGECGKAFSQSAHLRKHQRVHTGEKPYECNDCGKPFSRVSNL
  IKHHRVHTGEKPYKCSDCGKAFSQSSSLIQHRRIHTGEKPHVCNVCGKAFSYSSVLRKHQ
  IIHTGEKPYRCSVCGKAFSHSSALIQHQGVHTGDKPYACHECGKTFGRSSNLILHQRVHT
  GEKPYECTECGKTFSQSSTLIQHQRIHNGLKPHECNQCGKAFNRSSNLIHHQKVHTGEKP
  YTCVECGKGFSQSSHLIQHQIIHTGERPYKCSECGKAFSQRSVLIQHQRIHTGVKPYDCA
  ACGKAFSQRSKLIKHQLIHTRE

• Sequence length: 682

Related Genes

No strongly related genes found yet for ZNF16.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ZNF16.