ZNF137P (zinc finger protein 137, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 7696
Gene name Zinc finger protein 137, pseudogene
Gene symbol ZNF137P
Synonyms (NCBI Gene)
ZNF137pHZ-30
Chromosome 19
Chromosome location 19q13.41
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
604079 12921 HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P52743
Protein name Putative zinc finger protein 137 (Zinc finger protein 137 pseudogene)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 156 → 178 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 131 → 150 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 72 → 94 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 100 → 122 Zinc finger, C2H2 type Domain
Sequence 
MNVARFLVEKHTLHVIIDFILSKVSNQQSNLAQHQRVYTGEKPYKCNEWGKALSGKSSLF
YHQAIHGVGKLCKCNDCHKVFSNATTIANHWRIHNEDRSYKCNKCGKIFRHRSYLAVYQR
THTGEKPYKYHDCGKVFSQASSYAKHRRIHTGEKPHKCDDCGKVLTSRSHLIRHQRIHTG
QKSYKCLKCGKVFSLWALHAEHQKIHF
Sequence length 207
Interactions View interactions

No strongly related genes found yet for ZNF137P.

No additional diseases found yet through genes similar to ZNF137P.