ZMYND12 (zinc finger MYND-type containing 12)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 84217
Gene name Zinc finger MYND-type containing 12
Gene symbol ZMYND12
Synonyms (NCBI Gene)
-
Chromosome 1
Chromosome location 1p34.2
miRNA miRNA information provided by mirtarbase database.
7 Show/Hide all (7)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1515362 hsa-miR-4264 CLIP-seq
MIRT1515363 hsa-miR-4704-3p CLIP-seq
MIRT1515364 hsa-miR-485-3p CLIP-seq
MIRT1515365 hsa-miR-510 CLIP-seq
MIRT1515366 hsa-miR-512-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005929 Component Cilium IEA
GO:0007288 Process Sperm axoneme assembly IMP 37934199
GO:0008270 Function Zinc ion binding IEA
GO:0030317 Process Flagellated sperm motility IMP 37934199
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H0C1
Protein name Zinc finger MYND domain-containing protein 12
Protein function Required for sperm flagellum function and male fertility.
PDB 8J07
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01753 zf-MYND 17 → 54 MYND finger Domain
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in the testis. {ECO:0000269|PubMed:37934199}.
Sequence 
MNVIYPLAVPKGRRLCCEVCEAPAERVCAACTVTYYCGVVHQKADWDSIHEKICQLLIPL
RTSMPFYNSEEERQHGLQQLQQRQKYLIEFCYTIAQKYLFEGKHEDAVPAALQSLRFRVK
LYGLSSVELVPAYLLLAEASLGLGRIVQAEEYLFQAQWTVLKSTDCSNATHSLLHRNLGL
LYIAKKNYEEARYHLANDIYFASCAFGTEDIRTSGGYFHLANIFYDLKKLDLADTLYTKV
SEIWHAYLNNHYQVLSQAHIQQMDLLGKLFENDTGLDEAQEAEAIRILTSILNIRESTSD
KAPQKTIFVLKILVMFYYLMMNSSKAQEYGMRALSLAKEQQLDVHEQSTIQELLSLISTE
DHPIT
Sequence length 365
Interactions View interactions

No strongly related genes found yet for ZMYND12.

No additional diseases found yet through genes similar to ZMYND12.