Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	55888
Gene name	Zinc finger with KRAB and SCAN domains 7
Gene symbol	ZKSCAN7
Synonyms (NCBI Gene)	ZFPZNF167ZNF448ZNF64ZSCAN39
Chromosome	3
Chromosome location	3p21.31

miRTarBase ID	miRNA	Experiments	Reference
MIRT029900	hsa-miR-26b-5p	Microarray	19088304
MIRT051676	hsa-let-7e-5p	CLASH	23622248

11 Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 26871637, 31515488, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9P0L1

Protein name

Zinc finger protein with KRAB and SCAN domains 7 (Zinc finger protein 167) (Zinc finger protein 448) (Zinc finger protein 64)

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	691 → 713	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	663 → 685	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	635 → 657	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	411 → 433	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	383 → 405	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	579 → 601	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	523 → 545	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	719 → 741	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	439 → 461	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	551 → 573	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	467 → 489	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	495 → 517	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	607 → 629	Zinc finger, C2H2 type	Domain
PF01352	KRAB	230 → 270	KRAB box	Family
PF02023	SCAN	50 → 139	SCAN domain	Domain

Sequence

MTTAGRGNLGLIPRSTAFQKQEGRLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFRQL
CYHEMSGPQEALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPE
SGEEAVAVVEDFQRHLSGSEEVSAPAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAH
LEPPYDPGTHHLPSGDFAQCTSPVPTLPQVGNSGDQAGATVLRMVRPQDTVAYEDLSVDY
TQKKWKSLTLSQRALQWNMMPENHHSMASLAGENMMKGSELTPKQEFFKGSESSNRTSGG
LFGVVPGAAETGDVCEDTFKELEGQTSDEEGSRLENDFLEITDEDKKKSTKDRYDKYKEV
GEHPPLSSSPVEHEGVLKGQKSYRCDECGKAFNRSSHLIGHQRIHTGEKPYECNECGKTF
RQTSQLIVHLRTHTGEKPYECSECGKAYRHSSHLIQHQRLHNGEKPYKCNECAKAFTQSS
RLTDHQRTHTGEKPYECNECGEAFIRSKSLARHQVLHTGKKPYKCNECGRAFCSNRNLID
HQRIHTGEKPYECSECGKAFSRSKCLIRHQSLHTGEKPYKCSECGKAFNQNSQLIEHERI
HTGEKPFECSECGKAFGLSKCLIRHQRLHTGEKPYKCNECGKSFNQNSHLIIHQRIHTGE
KPYECNECGKVFSYSSSLMVHQRTHTGEKPYKCNDCGKAFSDSSQLIVHQRVHTGEKPYE
CSECGKAFSQRSTFNHHQRTHTGEKSSGLAWSVS

Sequence length

754

Interactions

View interactions

Reactome Pathway
Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	30718454, 41233554	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (8)
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	21864053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Stenosis Supravalvular	Aortic stenosis	Pubtator	22891920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	22828502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	22828502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	31784501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25360542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16731852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23314702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with ZKSCAN7 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for ZKSCAN7.

Diseases Linked via Similar Genes Diseases curated for genes most similar to ZKSCAN7 (see Related Genes above), that are NOT already directly curated for ZKSCAN7 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to ZKSCAN7.

ZKSCAN7 (zinc finger with KRAB and SCAN domains 7)

Bookmark This Gene