Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	23619
Gene name	Zinc finger imprinted 2
Gene symbol	ZIM2
Synonyms (NCBI Gene)	ZNF656
Chromosome	19
Chromosome location	19q13.43
Summary	In human, ZIM2 and PEG3 (GeneID:5178) are two distinct genes that share a set of 5` exons and have a common promoter, and both genes are paternally expressed. Alternative splicing events connect the shared exons either with the remaining 4 exons unique to

14 Show/Hide all (14)

miRTarBase ID	miRNA	Experiments
MIRT1513615	hsa-miR-409-3p	CLIP-seq
MIRT1513616	hsa-miR-4266	CLIP-seq
MIRT1513617	hsa-miR-4695-5p	CLIP-seq
MIRT1513618	hsa-miR-4779	CLIP-seq
MIRT1513619	hsa-miR-4786-3p	CLIP-seq
MIRT1513620	hsa-miR-539	CLIP-seq
MIRT1513621	hsa-miR-580	CLIP-seq
MIRT1513622	hsa-miR-671-5p	CLIP-seq
MIRT1513616	hsa-miR-4266	CLIP-seq
MIRT1513617	hsa-miR-4695-5p	CLIP-seq
MIRT1513618	hsa-miR-4779	CLIP-seq
MIRT1513616	hsa-miR-4266	CLIP-seq
MIRT1513617	hsa-miR-4695-5p	CLIP-seq
MIRT1513618	hsa-miR-4779	CLIP-seq

10 Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	34673265
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	10708526
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	34673265
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	NAS	10708526
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9NZV7

Protein name

Zinc finger imprinted 2 (Zinc finger protein 656)

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	466 → 488	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	494 → 516	Zinc finger, C2H2 type	Domain
PF01352	KRAB	175 → 216	KRAB box	Family
PF13894	zf-C2H2_4	328 → 351		Domain

Tissue specificity

TISSUE SPECIFICITY: Highest levels of expression in adult testis; modest levels in fetal kidney and brain.

Sequence

MYQPEDDNNSDVTSDDDMTRNRRESSPPHSVHSFSGDRDWDRRGRSRDMEPRDRWSHTRN
PRSRMPPRDLSLPVVAKTSFEMDREDDRDSRAYESRSQDAESYQNVVDLAEDRKPHNTIQ
DNMENYRKLLSLGFLAQDSVPAEKRNTEMLDNLPSAGSQFPDFKHLGTFLVFEELVTFED
VLVDFSPEELSSLSAAQRNLYREVMLENYRNLVSLGHQFSKPDIISRLEEEESYAMETDS
RHTVICQGESHDDPLEPHQGNQEKLLTPITMNDPKTLTPERSYGSDEFERSSNLSKQSKD
PLGKDPQEGTAPGICTSPQSASQENKHNRCEFCKRTFSTQVALRRHERIHTGKKPYECKQ
CAEAFYLMPHLNRHQKTHSGRKTSGCNEGRKPSVQCANLCERVRIHSQEDYFECFQCGKA
FLQNVHLLQHLKAHEAARVLPPGLSHSKTYLIRYQRKHDYVGERACQCCDCGRVFSRNSY
LIQHYRTHTQERPYQCQLCGKCFGRPSYLTQHYQLHSQEKTVECDHC

Sequence length

527

Interactions

View interactions

Reactome Pathway
Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, ADENOID CYSTIC	—	CTD	16762588	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SALIVARY GLAND NEOPLASMS	—	CTD	16762588	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoid Cystic Carcinoma	Adenocarcinoma	CTD_human_DG	16762588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	CTD_human_DG	16762588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	CTD_human_DG	16762588		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Diseases	Uterine polyp	Pubtator	36552753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZIM2 (zinc finger imprinted 2)

Save This Analysis