ZFPL1 (zinc finger protein like 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 7542
Gene name Zinc finger protein like 1
Gene symbol ZFPL1
Synonyms (NCBI Gene)
D11S750MCG4
Chromosome 11
Chromosome location 11q13.1
miRNA miRNA information provided by mirtarbase database.
7 Show/Hide all (7)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT028580 hsa-miR-30a-5p Proteomics 18668040
MIRT051227 hsa-miR-16-5p CLASH 23622248
MIRT1511987 hsa-miR-105 CLIP-seq
MIRT2154134 hsa-miR-4290 CLIP-seq
MIRT2154135 hsa-miR-885-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding NAS 9653652
GO:0005515 Function Protein binding IPI 32296183, 33961781
GO:0005634 Component Nucleus NAS 9653652
GO:0005794 Component Golgi apparatus IBA
GO:0005794 Component Golgi apparatus IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
619397 12868 ENSG00000162300
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95159
Protein name Zinc finger protein-like 1 (Zinc finger protein MCG4)
Protein function Required for cis-Golgi integrity and efficient ER to Golgi transport. Involved in the maintenance of the integrity of the cis-Golgi, possibly via its interaction with GOLGA2/GM130.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed strongly in the exocrine pancreas. {ECO:0000269|PubMed:9653652}.
Sequence 
MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNIPL
ASRETTRLVCYDLFHWACLNERAAQLPRNTAPAGYQCPSCNGPIFPPTNLAGPVASALRE
KLATVNWARAGLGLPLIDEVVSPEPEPLNTSDFSDWSSFNASSTPGPEEVDSASAAPAFY
SQAPRPPASPGRPEQHTVIHMGNPEPLTHAPRKVYDTRDDDRTPGLHGDCDDDKYRRRPA
LGWLARLLRSRAGSRKRPLTLLQRAGLLLLLGLLGFLALLALMSRLGRAAADSDPNLDPL
MNPHIRVGPS
Sequence length 310
Interactions View interactions

No strongly related genes found yet for ZFPL1.

No additional diseases found yet through genes similar to ZFPL1.