ZFP92 (ZFP92 zinc finger protein)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 139735
Gene name ZFP92 zinc finger protein
Gene symbol ZFP92
Synonyms (NCBI Gene)
ZNF897
Chromosome X
Chromosome location Xq28
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20 Show/Hide all (20)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0001227 Function DNA-binding transcription repressor activity, RNA polymerase II-specific IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
301139 12865 ENSG00000189420
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NM28
Protein name Zinc finger protein 92 homolog (Zfp-92)
Protein function KRAB domain-containing zinc-finger protein that represses B1/Alu SINE transposable elements and modulates the transcription of nearby genes in a tissue-specific manner. It regulates glucose homeostasis and lipid metabolism by modulating the expr
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 264 → 286 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 208 → 230 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 348 → 370 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 152 → 174 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 180 → 202 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 320 → 342 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 236 → 258 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 292 → 314 Zinc finger, C2H2 type Domain
PF01352 KRAB 13 → 54 KRAB box Family
Sequence 
MAAILLTTRPKVPVSFEDVSVYFTKTEWKLLDLRQKVLYKRVMLENYSHLVSLGFSFSKP
HLISQLERGEGPWVADIPRTWATAGLHIGDRTQSKTSTSTQKHSGRQLPGADPQGGKEGQ
AARSSVLQRGAQGLGQSSAAGPQGPKGAEKRYLCQQCGKAFSRSSNLIKHRIIHSGEKPY
ACPECGKLFRRSFALLEHQRIHSGEKPYACPECSKTFTRSSNLIKHQVIHSGERPFACGD
CGKLFRRSFALLEHARVHSGERPYACPECGKAFSRSSNLIEHQRTHRGEKPYACGQCAKA
FKGVSQLIHHQRSHSGERPFACRECGKAFRGRSGLSQHRRVHSGEKPYECSDCGKAFGRR
ANLFKHQAVHGARRPAKAETARRLAGPGSTGPGSAVAATSPPRPSTAARPSRPSRR
Sequence length 416
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
ZFP92-related disorder Uncertain significance ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations

No strongly related genes found yet for ZFP92.

No additional diseases found yet through genes similar to ZFP92.