ZFP2 (ZFP2 zinc finger protein)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 80108
Gene name ZFP2 zinc finger protein
Gene symbol ZFP2
Synonyms (NCBI Gene)
ZNF751zfp-2
Chromosome 5
Chromosome location 5q35.3
miRNA miRNA information provided by mirtarbase database.
10 Show/Hide all (10)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017994 hsa-miR-335-5p Microarray 18185580
MIRT2153877 hsa-miR-1825 CLIP-seq
MIRT2153878 hsa-miR-199a-5p CLIP-seq
MIRT2153879 hsa-miR-199b-5p CLIP-seq
MIRT2153880 hsa-miR-23a CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 25416956, 31515488, 32296183, 32814053
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6ZN57
Protein name Zinc finger protein ZFP2 (Zfp-2) (Zinc finger protein 751)
Protein function Probable transcription factor involved in neuronal differentiation and/or phenotypic maintenance.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 438 → 460 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 158 → 180 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 214 → 236 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 410 → 432 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 242 → 264 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 326 → 348 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 102 → 124 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 298 → 320 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 382 → 404 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 130 → 152 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 270 → 292 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 186 → 208 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 354 → 376 Zinc finger, C2H2 type Domain
Sequence 
MEREGIWHSTLGETWEPNNWLEGQQDSHLSQVGVTHKETFTEMRVCGGNEFERCSSQDSI
LDTQQSIPMVKRPHNCNSHGEDATQNSELIKTQRMFVGKKIYECNQCSKTFSQSSSLLKH
QRIHTGEKPYKCNVCGKHFIERSSLTVHQRIHTGEKPYKCNECGKAFSQSMNLTVHQRTH
TGEKPYQCKECGKAFHKNSSLIQHERIHTGEKPYKCNECGKAFTQSMNLTVHQRTHTGEK
PYECNECGKAFSQSMHLIVHQRSHTGEKPYECSQCGKAFSKSSTLTLHQRNHTGEKPYKC
NKCGKSFSQSTYLIEHQRLHSGVKPFECNECGKAFSKNSSLTQHRRIHTGEKPYECMVCG
KHFTGRSSLTVHQVIHTGEKPYECNECGKAFSQSAYLIEHQRIHTGEKPYECDQCGKAFI
KNSSLTVHQRTHTGEKPYQCNECGKAFSRSTNLTRHQRTHT
Sequence length 461
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Generic Transcription Pathway

No strongly related genes found yet for ZFP2.

No additional diseases found yet through genes similar to ZFP2.