ZDHHC1 (zDHHC palmitoyltransferase 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 29800
• Gene name: ZDHHC palmitoyltransferase 1
• Gene symbol: ZDHHC1
• Synonyms (NCBI Gene): C16orf1, DHHC-1, HSU90653, ZNF377
• Chromosome: 16
• Chromosome location: 16q22.1

Gene ontology (GO) Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002230	Process	Positive regulation of defense response to virus by host	IMP	25299331
GO:0003677	Function	DNA binding	NAS	10395086
GO:0005515	Function	Protein binding	IPI	25299331, 32296183
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	16647879
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	25299331
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA	25299331
GO:0005794	Component	Golgi apparatus	IEA
GO:0006612	Process	Protein targeting to membrane	IBA
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016409	Function	Palmitoyltransferase activity	IDA	23034182
GO:0016409	Function	Palmitoyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	IBA
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	IDA	39173637
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	IEA
GO:0044546	Process	NLRP3 inflammasome complex assembly	IDA	35114687, 35254907
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0140374	Process	Antiviral innate immune response	IBA
GO:0140374	Process	Antiviral innate immune response	IMP	25299331
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IDA	31189953
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IDA	39173637

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q8WTX9
• Protein name: Palmitoyltransferase ZDHHC1 (EC 2.3.1.225) (DHHC domain-containing cysteine-rich protein 1) (Zinc finger DHHC domain-containing protein 1) (DHHC-1) (Zinc finger protein 377)
• Protein function: Palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates, such as NCDN and NLRP3 (PubMed:39173637). Has a palmitoyltransferase activity toward NCDN and regulates NCDN association with endosome membranes throu
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01529	DHHC	129 → 285	DHHC palmitoyltransferase	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with significant expression in heart, brain, placenta, lung, liver, kidney, testis, thymus and small intestine (PubMed:16647879). Expressed at lower levels in adult pancreas and lung (PubMed:10395086). {ECO:0000269|Pub
• Sequence:

  MYKMNICNKPSNKTAPEKSVWTAPAQPSGPSPELQGQRSRRNGWSWPPHPLQIVAWLLYL
  FFAVIGFGILVPLLPHHWVPAGYACMGAIFAGHLVVHLTAVSIDPADANVRDKSYAGPLP
  IFNRSQHAHVIEDLHCNLCNVDVSARSKHCSACNKCVCGFDHHCKWLNNCVGERNYRLFL
  HSVASALLGVLLLVLVATYVFVEFFVNPMRLRTNRHFEVLKNHTDVWFVFLPAAPVETQA
  PAILALAALLILLGLLSTALLGHLLCFHIYLMWHKLTTYEYIVQHRPPQEAKGVHRELES
  CPPKMRPIQEMEFYMRTFRHMRPEPPGQAGPAAVNAKHSRPASPDPTPGRRDCAGPPVQV
  EWDRKKPLPWRSPLLLLAMWGPQAPPCLCRKRGRGACIKCERLRPRIRRRGLGPPAAAPA
  RRRIPRTPALCTPLALPAPTTRRRQSPWTRFQWRRRAWAAPLWPPRGAGADSPRWRGRRV
  RPPFS

• Sequence length: 485

Pathways

KEGG Pathway:

Cytosolic DNA-sensing pathway

Related Genes

No strongly related genes found yet for ZDHHC1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ZDHHC1.