ZC3H3 (zinc finger CCCH-type containing 3)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 23144
• Gene name: Zinc finger CCCH-type containing 3
• Gene symbol: ZC3H3
• Synonyms (NCBI Gene): SMICL, ZC3HDC3
• Chromosome: 8
• Chromosome location: 8q24.3

miRNA Show/Hide all (68)

miRTarBase ID	miRNA	Experiments	Reference
MIRT040908	hsa-miR-18a-3p	CLASH	23622248
MIRT039752	hsa-miR-615-3p	CLASH	23622248
MIRT1505864	hsa-miR-1238	CLIP-seq
MIRT1505865	hsa-miR-125a-3p	CLIP-seq
MIRT1505866	hsa-miR-1908	CLIP-seq
MIRT1505867	hsa-miR-2278	CLIP-seq
MIRT1505868	hsa-miR-2467-5p	CLIP-seq
MIRT1505869	hsa-miR-3124-3p	CLIP-seq
MIRT1505870	hsa-miR-3138	CLIP-seq
MIRT1505871	hsa-miR-3165	CLIP-seq
MIRT1505872	hsa-miR-3183	CLIP-seq
MIRT1505873	hsa-miR-3188	CLIP-seq
MIRT1505874	hsa-miR-3202	CLIP-seq
MIRT1505875	hsa-miR-339-5p	CLIP-seq
MIRT1505876	hsa-miR-361-3p	CLIP-seq
MIRT1505877	hsa-miR-3616-3p	CLIP-seq
MIRT1505878	hsa-miR-3657	CLIP-seq
MIRT1505879	hsa-miR-3975	CLIP-seq
MIRT1505880	hsa-miR-4316	CLIP-seq
MIRT1505881	hsa-miR-4514	CLIP-seq
MIRT1505882	hsa-miR-4519	CLIP-seq
MIRT1505883	hsa-miR-4520a-3p	CLIP-seq
MIRT1505884	hsa-miR-4533	CLIP-seq
MIRT1505885	hsa-miR-4640-5p	CLIP-seq
MIRT1505886	hsa-miR-4645-5p	CLIP-seq
MIRT1505887	hsa-miR-4673	CLIP-seq
MIRT1505888	hsa-miR-4692	CLIP-seq
MIRT1505889	hsa-miR-4710	CLIP-seq
MIRT1505890	hsa-miR-4721	CLIP-seq
MIRT1505891	hsa-miR-4723-3p	CLIP-seq
MIRT1505892	hsa-miR-4726-3p	CLIP-seq
MIRT1505893	hsa-miR-4726-5p	CLIP-seq
MIRT1505894	hsa-miR-4755-3p	CLIP-seq
MIRT1505895	hsa-miR-4767	CLIP-seq
MIRT1505896	hsa-miR-485-5p	CLIP-seq
MIRT1505897	hsa-miR-490-5p	CLIP-seq
MIRT1505898	hsa-miR-663	CLIP-seq
MIRT1505899	hsa-miR-663b	CLIP-seq
MIRT1505900	hsa-miR-940	CLIP-seq
MIRT2152292	hsa-miR-137	CLIP-seq
MIRT1505869	hsa-miR-3124-3p	CLIP-seq
MIRT2152293	hsa-miR-4788	CLIP-seq
MIRT2152294	hsa-miR-628-5p	CLIP-seq
MIRT1505864	hsa-miR-1238	CLIP-seq
MIRT2397262	hsa-miR-1255a	CLIP-seq
MIRT2397263	hsa-miR-1255b	CLIP-seq
MIRT1505869	hsa-miR-3124-3p	CLIP-seq
MIRT1505872	hsa-miR-3183	CLIP-seq
MIRT1505891	hsa-miR-4723-3p	CLIP-seq
MIRT2397264	hsa-miR-515-5p	CLIP-seq
MIRT1505869	hsa-miR-3124-3p	CLIP-seq
MIRT1505870	hsa-miR-3138	CLIP-seq
MIRT1505871	hsa-miR-3165	CLIP-seq
MIRT1505883	hsa-miR-4520a-3p	CLIP-seq
MIRT2665573	hsa-miR-3144-5p	CLIP-seq
MIRT2665574	hsa-miR-3191	CLIP-seq
MIRT1505874	hsa-miR-3202	CLIP-seq
MIRT2665575	hsa-miR-342-5p	CLIP-seq
MIRT2665576	hsa-miR-3620	CLIP-seq
MIRT2665577	hsa-miR-4308	CLIP-seq
MIRT1505884	hsa-miR-4533	CLIP-seq
MIRT2665578	hsa-miR-4651	CLIP-seq
MIRT2665579	hsa-miR-4652-5p	CLIP-seq
MIRT2665580	hsa-miR-4664-5p	CLIP-seq
MIRT2665581	hsa-miR-491-5p	CLIP-seq
MIRT2665582	hsa-miR-541	CLIP-seq
MIRT2665583	hsa-miR-608	CLIP-seq
MIRT2665584	hsa-miR-654-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16115198, 19364924
GO:0005634	Component	Nucleus	IEA
GO:0005847	Component	MRNA cleavage and polyadenylation specificity factor complex	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0031124	Process	MRNA 3'-end processing	IEA
GO:0032927	Process	Positive regulation of activin receptor signaling pathway	IEA
GO:0046332	Function	SMAD binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051028	Process	MRNA transport	IEA
GO:0070412	Function	R-SMAD binding	IEA

Other IDs

• MIM: 618640
• HGNC: 28972
• e!Ensembl: ENSG00000014164

Protein

• UniProt ID: Q8IXZ2
• Protein name: Zinc finger CCCH domain-containing protein 3 (Smad-interacting CPSF-like factor)
• Protein function: Required for the export of polyadenylated mRNAs from the nucleus (PubMed:19364924). Enhances ACVR1B-induced SMAD-dependent transcription. Binds to single-stranded DNA but not to double-stranded DNA in vitro. Involved in RNA cleavage (By similari
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00642	zf-CCCH	668 → 694	Zinc finger C-x8-C-x5-C-x3-H type (and similar)	Family
  PF00642	zf-CCCH	773 → 798	Zinc finger C-x8-C-x5-C-x3-H type (and similar)	Family

• Sequence:

  MEEKEILRRQIRLLQGLIDDYKTLHGNAPAPGTPAASGWQPPTYHSGRAFSARYPRPSRR
  GYSSHHGPSWRKKYSLVNRPPGPSDPPADHAVRPLHGARGGQPPVPQQHVLERQVQLSQG
  QNVVIKVKPPSKSGSASASGAQRGSLEEFEETPWSDQRPREGEGEPPRGQLQPSRPTRAR
  GTCSVEDPLLVCQKEPGKPRMVKSVGSVGDSPREPRRTVSESVIAVKASFPSSALPPRTG
  VALGRKLGSHSVASCAPQLLGDRRVDAGHTDQPVPSGSVGGPARPASGPRQAREASLVVT
  CRTNKFRKNNYKWVAASSKSPRVARRALSPRVAAENVCKASAGMANKVEKPQLIADPEPK
  PRKPATSSKPGSAPSKYKWKASSPSASSSSSFRWQSEASSKDHASQLSPVLSRSPSGDRP
  AVGHSGLKPLSGETPLSAYKVKSRTKIIRRRSSTSLPGDKKSGTSPAATAKSHLSLRRRQ
  ALRGKSSPVLKKTPNKGLVQVTTHRLCRLPPSRAHLPTKEASSLHAVRTAPTSKVIKTRY
  RIVKKTPASPLSAPPFPLSLPSWRARRLSLSRSLVLNRLRPVASGGGKAQPGSPWWRSKG
  YRCIGGVLYKVSANKLSKTSGQPSDAGSRPLLRTGRLDPAGSCSRSLASRAVQRSLAIIR
  QARQRREKRKEYCMYYNRFGRCNRGERCPYIHDPEKVAVCTRFVRGTCKKTDGTCPFSHH
  VSKEKMPVCSYFLKGICSNSNCPYSHVYVSRKAEVCSDFLKGYCPLGAKCKKKHTLLCPD
  FARRGACPRGAQCQLLHRTQKRHSRRAATSPAPGPSDATARSRVSASHGPRKPSASQRPT
  RQTPSSAALTAAAVAAPPHCPGGSASPSSSKASSSSSSSSSPPASLDHEAPSLQEAALAA
  ACSNRLCKLPSFISLQSSPSPGAQPRVRAPRAPLTKDSGKPLHIKPRL

• Sequence length: 948

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Colon adenocarcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Decreased total lymphocyte count	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Decreased total neutrophil count	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	33725886	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33059309	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38302914	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	21211798		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for ZC3H3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ZC3H3.