ZBTB9 (zinc finger and BTB domain containing 9)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Diseases linked via similar genes

Gene

• Entrez ID: 221504
• Gene name: Zinc finger and BTB domain containing 9
• Gene symbol: ZBTB9
• Synonyms (NCBI Gene): ZNF919
• Chromosome: 6
• Chromosome location: 6p21.32

miRNA Show/Hide all (201)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023727	hsa-miR-1-3p	Microarray	18668037
MIRT041045	hsa-miR-505-3p	CLASH	23622248
MIRT100457	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT100454	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439254	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT100457	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT100452	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT100460	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT100455	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT100462	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT100454	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439254	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1505161	hsa-miR-106a	CLIP-seq
MIRT1505162	hsa-miR-106b	CLIP-seq
MIRT1505163	hsa-miR-1227	CLIP-seq
MIRT1505164	hsa-miR-1245	CLIP-seq
MIRT1505165	hsa-miR-140-5p	CLIP-seq
MIRT1505166	hsa-miR-15a	CLIP-seq
MIRT1505167	hsa-miR-15b	CLIP-seq
MIRT1505168	hsa-miR-16	CLIP-seq
MIRT1505169	hsa-miR-17	CLIP-seq
MIRT1505170	hsa-miR-186	CLIP-seq
MIRT1505171	hsa-miR-195	CLIP-seq
MIRT1505172	hsa-miR-2053	CLIP-seq
MIRT1505173	hsa-miR-20a	CLIP-seq
MIRT1505174	hsa-miR-20b	CLIP-seq
MIRT1505175	hsa-miR-214	CLIP-seq
MIRT1505176	hsa-miR-302a	CLIP-seq
MIRT1505177	hsa-miR-302b	CLIP-seq
MIRT1505178	hsa-miR-302c	CLIP-seq
MIRT1505179	hsa-miR-302d	CLIP-seq
MIRT1505180	hsa-miR-302e	CLIP-seq
MIRT1505181	hsa-miR-3126-5p	CLIP-seq
MIRT1505182	hsa-miR-3133	CLIP-seq
MIRT1505183	hsa-miR-34a	CLIP-seq
MIRT1505184	hsa-miR-34c-5p	CLIP-seq
MIRT1505185	hsa-miR-3609	CLIP-seq
MIRT1505186	hsa-miR-3619-5p	CLIP-seq
MIRT1505187	hsa-miR-3650	CLIP-seq
MIRT1505188	hsa-miR-372	CLIP-seq
MIRT1505189	hsa-miR-373	CLIP-seq
MIRT1505190	hsa-miR-424	CLIP-seq
MIRT1505191	hsa-miR-4263	CLIP-seq
MIRT1505192	hsa-miR-4273	CLIP-seq
MIRT1505193	hsa-miR-4291	CLIP-seq
MIRT1505194	hsa-miR-4419a	CLIP-seq
MIRT1505195	hsa-miR-449a	CLIP-seq
MIRT1505196	hsa-miR-449b	CLIP-seq
MIRT1505197	hsa-miR-4510	CLIP-seq
MIRT1505198	hsa-miR-4519	CLIP-seq
MIRT1505199	hsa-miR-4659a-5p	CLIP-seq
MIRT1505200	hsa-miR-4659b-5p	CLIP-seq
MIRT1505201	hsa-miR-4668-5p	CLIP-seq
MIRT1505202	hsa-miR-4677-5p	CLIP-seq
MIRT1505203	hsa-miR-4777-5p	CLIP-seq
MIRT1505204	hsa-miR-4796-3p	CLIP-seq
MIRT1505205	hsa-miR-494	CLIP-seq
MIRT1505206	hsa-miR-497	CLIP-seq
MIRT1505207	hsa-miR-518d-5p	CLIP-seq
MIRT1505208	hsa-miR-519b-5p	CLIP-seq
MIRT1505209	hsa-miR-519c-5p	CLIP-seq
MIRT1505210	hsa-miR-519d	CLIP-seq
MIRT1505211	hsa-miR-520a-3p	CLIP-seq
MIRT1505212	hsa-miR-520b	CLIP-seq
MIRT1505213	hsa-miR-520c-3p	CLIP-seq
MIRT1505214	hsa-miR-520c-5p	CLIP-seq
MIRT1505215	hsa-miR-520d-3p	CLIP-seq
MIRT1505216	hsa-miR-520e	CLIP-seq
MIRT1505217	hsa-miR-526a	CLIP-seq
MIRT1505218	hsa-miR-548ah	CLIP-seq
MIRT1505219	hsa-miR-548l	CLIP-seq
MIRT1505220	hsa-miR-548n	CLIP-seq
MIRT1505221	hsa-miR-548t	CLIP-seq
MIRT1505222	hsa-miR-761	CLIP-seq
MIRT1505223	hsa-miR-922	CLIP-seq
MIRT1505224	hsa-miR-93	CLIP-seq
MIRT1505161	hsa-miR-106a	CLIP-seq
MIRT1505162	hsa-miR-106b	CLIP-seq
MIRT2152064	hsa-miR-1293	CLIP-seq
MIRT2152065	hsa-miR-145	CLIP-seq
MIRT1505169	hsa-miR-17	CLIP-seq
MIRT2152066	hsa-miR-197	CLIP-seq
MIRT2152067	hsa-miR-202	CLIP-seq
MIRT1505172	hsa-miR-2053	CLIP-seq
MIRT1505173	hsa-miR-20a	CLIP-seq
MIRT1505174	hsa-miR-20b	CLIP-seq
MIRT2152068	hsa-miR-2276	CLIP-seq
MIRT1505176	hsa-miR-302a	CLIP-seq
MIRT1505177	hsa-miR-302b	CLIP-seq
MIRT1505178	hsa-miR-302c	CLIP-seq
MIRT1505179	hsa-miR-302d	CLIP-seq
MIRT1505180	hsa-miR-302e	CLIP-seq
MIRT2152069	hsa-miR-3153	CLIP-seq
MIRT1505185	hsa-miR-3609	CLIP-seq
MIRT2152070	hsa-miR-361-5p	CLIP-seq
MIRT1505188	hsa-miR-372	CLIP-seq
MIRT1505189	hsa-miR-373	CLIP-seq
MIRT2152071	hsa-miR-3913-3p	CLIP-seq
MIRT2152072	hsa-miR-4282	CLIP-seq
MIRT2152073	hsa-miR-4483	CLIP-seq
MIRT2152074	hsa-miR-4654	CLIP-seq
MIRT1505201	hsa-miR-4668-5p	CLIP-seq
MIRT2152075	hsa-miR-4747-5p	CLIP-seq
MIRT2152076	hsa-miR-4769-5p	CLIP-seq
MIRT1505204	hsa-miR-4796-3p	CLIP-seq
MIRT2152077	hsa-miR-4796-5p	CLIP-seq
MIRT2152078	hsa-miR-499-3p	CLIP-seq
MIRT2152079	hsa-miR-499a-3p	CLIP-seq
MIRT1505210	hsa-miR-519d	CLIP-seq
MIRT1505211	hsa-miR-520a-3p	CLIP-seq
MIRT1505212	hsa-miR-520b	CLIP-seq
MIRT1505213	hsa-miR-520c-3p	CLIP-seq
MIRT1505215	hsa-miR-520d-3p	CLIP-seq
MIRT1505216	hsa-miR-520e	CLIP-seq
MIRT1505218	hsa-miR-548ah	CLIP-seq
MIRT1505221	hsa-miR-548t	CLIP-seq
MIRT2152080	hsa-miR-590-3p	CLIP-seq
MIRT1505224	hsa-miR-93	CLIP-seq
MIRT2372472	hsa-miR-1205	CLIP-seq
MIRT2372473	hsa-miR-1909	CLIP-seq
MIRT2372474	hsa-miR-218	CLIP-seq
MIRT2372475	hsa-miR-296-3p	CLIP-seq
MIRT1505176	hsa-miR-302a	CLIP-seq
MIRT1505177	hsa-miR-302b	CLIP-seq
MIRT1505178	hsa-miR-302c	CLIP-seq
MIRT1505179	hsa-miR-302d	CLIP-seq
MIRT1505180	hsa-miR-302e	CLIP-seq
MIRT2372476	hsa-miR-3074-5p	CLIP-seq
MIRT2372477	hsa-miR-3124-3p	CLIP-seq
MIRT2372478	hsa-miR-323-5p	CLIP-seq
MIRT2372479	hsa-miR-3529	CLIP-seq
MIRT2152070	hsa-miR-361-5p	CLIP-seq
MIRT1505188	hsa-miR-372	CLIP-seq
MIRT1505189	hsa-miR-373	CLIP-seq
MIRT2372480	hsa-miR-379	CLIP-seq
MIRT2372481	hsa-miR-3927	CLIP-seq
MIRT2372482	hsa-miR-4662a-5p	CLIP-seq
MIRT1505211	hsa-miR-520a-3p	CLIP-seq
MIRT1505212	hsa-miR-520b	CLIP-seq
MIRT1505213	hsa-miR-520c-3p	CLIP-seq
MIRT1505215	hsa-miR-520d-3p	CLIP-seq
MIRT1505216	hsa-miR-520e	CLIP-seq
MIRT2372483	hsa-miR-548m	CLIP-seq
MIRT2372484	hsa-miR-876-3p	CLIP-seq
MIRT2665410	hsa-miR-1	CLIP-seq
MIRT1505161	hsa-miR-106a	CLIP-seq
MIRT1505162	hsa-miR-106b	CLIP-seq
MIRT2665411	hsa-miR-1197	CLIP-seq
MIRT2665412	hsa-miR-1200	CLIP-seq
MIRT2152065	hsa-miR-145	CLIP-seq
MIRT1505169	hsa-miR-17	CLIP-seq
MIRT2665413	hsa-miR-1976	CLIP-seq
MIRT1505172	hsa-miR-2053	CLIP-seq
MIRT2665414	hsa-miR-206	CLIP-seq
MIRT1505173	hsa-miR-20a	CLIP-seq
MIRT1505174	hsa-miR-20b	CLIP-seq
MIRT2665415	hsa-miR-2277-3p	CLIP-seq
MIRT2665416	hsa-miR-23a	CLIP-seq
MIRT2665417	hsa-miR-23b	CLIP-seq
MIRT2665418	hsa-miR-23c	CLIP-seq
MIRT1505176	hsa-miR-302a	CLIP-seq
MIRT1505177	hsa-miR-302b	CLIP-seq
MIRT1505178	hsa-miR-302c	CLIP-seq
MIRT1505179	hsa-miR-302d	CLIP-seq
MIRT1505180	hsa-miR-302e	CLIP-seq
MIRT2665419	hsa-miR-3117-3p	CLIP-seq
MIRT2665420	hsa-miR-34c-3p	CLIP-seq
MIRT1505185	hsa-miR-3609	CLIP-seq
MIRT2665421	hsa-miR-3673	CLIP-seq
MIRT1505188	hsa-miR-372	CLIP-seq
MIRT1505189	hsa-miR-373	CLIP-seq
MIRT2665422	hsa-miR-4289	CLIP-seq
MIRT2665423	hsa-miR-4324	CLIP-seq
MIRT2152075	hsa-miR-4747-5p	CLIP-seq
MIRT1505204	hsa-miR-4796-3p	CLIP-seq
MIRT2665424	hsa-miR-4802-3p	CLIP-seq
MIRT1505205	hsa-miR-494	CLIP-seq
MIRT1505210	hsa-miR-519d	CLIP-seq
MIRT1505211	hsa-miR-520a-3p	CLIP-seq
MIRT1505212	hsa-miR-520b	CLIP-seq
MIRT1505213	hsa-miR-520c-3p	CLIP-seq
MIRT1505215	hsa-miR-520d-3p	CLIP-seq
MIRT1505216	hsa-miR-520e	CLIP-seq
MIRT2665425	hsa-miR-544b	CLIP-seq
MIRT1505218	hsa-miR-548ah	CLIP-seq
MIRT1505221	hsa-miR-548t	CLIP-seq
MIRT2665426	hsa-miR-613	CLIP-seq
MIRT2665427	hsa-miR-616	CLIP-seq
MIRT2665428	hsa-miR-651	CLIP-seq
MIRT2665429	hsa-miR-656	CLIP-seq
MIRT2665430	hsa-miR-758	CLIP-seq
MIRT1505224	hsa-miR-93	CLIP-seq
MIRT2665411	hsa-miR-1197	CLIP-seq
MIRT2665412	hsa-miR-1200	CLIP-seq
MIRT2665413	hsa-miR-1976	CLIP-seq
MIRT2665415	hsa-miR-2277-3p	CLIP-seq
MIRT2665419	hsa-miR-3117-3p	CLIP-seq
MIRT2665420	hsa-miR-34c-3p	CLIP-seq
MIRT2665423	hsa-miR-4324	CLIP-seq
MIRT2665425	hsa-miR-544b	CLIP-seq
MIRT2665428	hsa-miR-651	CLIP-seq

Gene ontology (GO) Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	20211142, 25416956, 28514442, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q96C00
• Protein name: Zinc finger and BTB domain-containing protein 9
• Protein function: May be involved in transcriptional regulation.
• PDB: 9B9V
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00651	BTB	38 → 142	BTB/POZ domain	Domain

• Sequence:

  METPTPLPPVPASPTCNPAPRTIQIEFPQHSSSLLESLNRHRLEGKFCDVSLLVQGRELR
  AHKAVLAAASPYFHDKLLLGDAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLL
  VASGLQMWQVVDQCSEILRELETSGGGISARGGNSYHALLSTTSSTGGWCIRSSPFQTPV
  QSSASTESPASTESPVGGEGSELGEVLQIQVEEEEEEEEDDDDEDQGSATLSQTPQPQRV
  SGVFPRPHGPHPLPMTATPRKLPEGESAPLELPAPPALPPKIFYIKQEPFEPKEEISGSG
  TQPGGAKEETKVFSGGDTEGNGELGFLLPSGPGPTSGGGGPSWKPVDLHGNEILSGGGGP
  GGAGQAVHGPVKLGGTPPADGKRFGCLCGKRFAVKPKRDRHIMLTFSLRPFGCGICNKRF
  KLKHHLTEHMKTHAGALHACPHCGRRFRVHACFLRHRDLCKGQGWATAHWTYK

• Sequence length: 473

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (17)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ASTHMA	—	GWAS catalog	31669095	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	34446935	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	31669095	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	32024964	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	30804565, 35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	28604730	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	28604730	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	28604730	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	38757301, 39885523	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	37377963	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	28604730	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	34446935	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	32024964	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	37377963	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36522647	Stimulate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for ZBTB9.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ZBTB9.