Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	166793
Gene name	Zinc finger and BTB domain containing 49
Gene symbol	ZBTB49
Synonyms (NCBI Gene)	ZNF509
Chromosome	4
Chromosome location	4p16.3

115 Show/Hide all (115)

miRTarBase ID	miRNA	Experiments	Reference
MIRT529714	hsa-miR-4779	PAR-CLIP	22012620
MIRT529713	hsa-miR-556-5p	PAR-CLIP	22012620
MIRT529712	hsa-miR-10b-3p	PAR-CLIP	22012620
MIRT529711	hsa-miR-4768-3p	PAR-CLIP	22012620
MIRT529710	hsa-miR-4459	PAR-CLIP	22012620
MIRT529709	hsa-miR-4433a-3p	PAR-CLIP	22012620
MIRT529708	hsa-miR-1249-5p	PAR-CLIP	22012620
MIRT529706	hsa-miR-6797-5p	PAR-CLIP	22012620
MIRT529707	hsa-miR-5100	PAR-CLIP	22012620
MIRT529705	hsa-miR-6807-5p	PAR-CLIP	22012620
MIRT529704	hsa-miR-3977	PAR-CLIP	22012620
MIRT529703	hsa-miR-3942-3p	PAR-CLIP	22012620
MIRT529714	hsa-miR-4779	PAR-CLIP	22012620
MIRT529713	hsa-miR-556-5p	PAR-CLIP	22012620
MIRT529712	hsa-miR-10b-3p	PAR-CLIP	22012620
MIRT529711	hsa-miR-4768-3p	PAR-CLIP	22012620
MIRT529710	hsa-miR-4459	PAR-CLIP	22012620
MIRT529709	hsa-miR-4433a-3p	PAR-CLIP	22012620
MIRT529708	hsa-miR-1249-5p	PAR-CLIP	22012620
MIRT529706	hsa-miR-6797-5p	PAR-CLIP	22012620
MIRT529707	hsa-miR-5100	PAR-CLIP	22012620
MIRT529705	hsa-miR-6807-5p	PAR-CLIP	22012620
MIRT529704	hsa-miR-3977	PAR-CLIP	22012620
MIRT529703	hsa-miR-3942-3p	PAR-CLIP	22012620
MIRT1504263	hsa-miR-2467-5p	CLIP-seq
MIRT1504264	hsa-miR-3188	CLIP-seq
MIRT1504265	hsa-miR-369-3p	CLIP-seq
MIRT1504266	hsa-miR-374c	CLIP-seq
MIRT1504267	hsa-miR-3975	CLIP-seq
MIRT1504268	hsa-miR-4329	CLIP-seq
MIRT1504269	hsa-miR-4649-3p	CLIP-seq
MIRT1504270	hsa-miR-4663	CLIP-seq
MIRT1504271	hsa-miR-4778-5p	CLIP-seq
MIRT1504272	hsa-miR-485-5p	CLIP-seq
MIRT1504273	hsa-miR-655	CLIP-seq
MIRT1504263	hsa-miR-2467-5p	CLIP-seq
MIRT1504264	hsa-miR-3188	CLIP-seq
MIRT1504267	hsa-miR-3975	CLIP-seq
MIRT1504268	hsa-miR-4329	CLIP-seq
MIRT1504269	hsa-miR-4649-3p	CLIP-seq
MIRT1504270	hsa-miR-4663	CLIP-seq
MIRT1504272	hsa-miR-485-5p	CLIP-seq
MIRT2372175	hsa-miR-23a	CLIP-seq
MIRT2372176	hsa-miR-23b	CLIP-seq
MIRT2372177	hsa-miR-23c	CLIP-seq
MIRT2372178	hsa-miR-4717-3p	CLIP-seq
MIRT2463817	hsa-miR-124	CLIP-seq
MIRT2463818	hsa-miR-149	CLIP-seq
MIRT2463819	hsa-miR-3064-5p	CLIP-seq
MIRT2463820	hsa-miR-3154	CLIP-seq
MIRT2463821	hsa-miR-326	CLIP-seq
MIRT2463822	hsa-miR-330-5p	CLIP-seq
MIRT2463823	hsa-miR-4794	CLIP-seq
MIRT2463824	hsa-miR-506	CLIP-seq
MIRT2463817	hsa-miR-124	CLIP-seq
MIRT2463818	hsa-miR-149	CLIP-seq
MIRT2463819	hsa-miR-3064-5p	CLIP-seq
MIRT2463820	hsa-miR-3154	CLIP-seq
MIRT2463821	hsa-miR-326	CLIP-seq
MIRT2463822	hsa-miR-330-5p	CLIP-seq
MIRT2463823	hsa-miR-4794	CLIP-seq
MIRT2463824	hsa-miR-506	CLIP-seq
MIRT2463817	hsa-miR-124	CLIP-seq
MIRT2463818	hsa-miR-149	CLIP-seq
MIRT1504263	hsa-miR-2467-5p	CLIP-seq
MIRT2463819	hsa-miR-3064-5p	CLIP-seq
MIRT2463820	hsa-miR-3154	CLIP-seq
MIRT2665354	hsa-miR-3182	CLIP-seq
MIRT1504264	hsa-miR-3188	CLIP-seq
MIRT2463821	hsa-miR-326	CLIP-seq
MIRT2463822	hsa-miR-330-5p	CLIP-seq
MIRT2665355	hsa-miR-3614-3p	CLIP-seq
MIRT2665356	hsa-miR-3679-3p	CLIP-seq
MIRT1504267	hsa-miR-3975	CLIP-seq
MIRT1504268	hsa-miR-4329	CLIP-seq
MIRT2665357	hsa-miR-4433	CLIP-seq
MIRT2665358	hsa-miR-4462	CLIP-seq
MIRT1504269	hsa-miR-4649-3p	CLIP-seq
MIRT1504270	hsa-miR-4663	CLIP-seq
MIRT2665359	hsa-miR-4677-3p	CLIP-seq
MIRT2665360	hsa-miR-4679	CLIP-seq
MIRT2665361	hsa-miR-4790-5p	CLIP-seq
MIRT2463823	hsa-miR-4794	CLIP-seq
MIRT1504272	hsa-miR-485-5p	CLIP-seq
MIRT2463824	hsa-miR-506	CLIP-seq
MIRT2695499	hsa-miR-1228	CLIP-seq
MIRT2463817	hsa-miR-124	CLIP-seq
MIRT2695500	hsa-miR-1470	CLIP-seq
MIRT2695501	hsa-miR-1471	CLIP-seq
MIRT2463818	hsa-miR-149	CLIP-seq
MIRT1504263	hsa-miR-2467-5p	CLIP-seq
MIRT2463819	hsa-miR-3064-5p	CLIP-seq
MIRT2463820	hsa-miR-3154	CLIP-seq
MIRT2665354	hsa-miR-3182	CLIP-seq
MIRT1504264	hsa-miR-3188	CLIP-seq
MIRT2463821	hsa-miR-326	CLIP-seq
MIRT2463822	hsa-miR-330-5p	CLIP-seq
MIRT2695502	hsa-miR-361-3p	CLIP-seq
MIRT2665355	hsa-miR-3614-3p	CLIP-seq
MIRT2665356	hsa-miR-3679-3p	CLIP-seq
MIRT1504267	hsa-miR-3975	CLIP-seq
MIRT2695503	hsa-miR-4267	CLIP-seq
MIRT1504268	hsa-miR-4329	CLIP-seq
MIRT2665357	hsa-miR-4433	CLIP-seq
MIRT2665358	hsa-miR-4462	CLIP-seq
MIRT2695504	hsa-miR-4469	CLIP-seq
MIRT1504269	hsa-miR-4649-3p	CLIP-seq
MIRT1504270	hsa-miR-4663	CLIP-seq
MIRT2695505	hsa-miR-4667-3p	CLIP-seq
MIRT2665359	hsa-miR-4677-3p	CLIP-seq
MIRT2665360	hsa-miR-4679	CLIP-seq
MIRT2665361	hsa-miR-4790-5p	CLIP-seq
MIRT2463823	hsa-miR-4794	CLIP-seq
MIRT1504272	hsa-miR-485-5p	CLIP-seq
MIRT2463824	hsa-miR-506	CLIP-seq

24 Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0001223	Function	Transcription coactivator binding	IPI	25245946
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001817	Process	Regulation of cytokine production	IBA
GO:0002682	Process	Regulation of immune system process	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 29892012, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	25245946
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	25245946
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	25245946
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0043565	Function	Sequence-specific DNA binding	IDA	25245946
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	25245946
GO:0046872	Function	Metal ion binding	IEA
GO:0051726	Process	Regulation of cell cycle	IDA	25245946
GO:0140297	Function	DNA-binding transcription factor binding	IDA	25245946

MIM	HGNC	e!Ensembl
616238	19883	ENSG00000168826

Q6ZSB9

Protein name

Zinc finger and BTB domain-containing protein 49 (Zinc finger protein 509)

Protein function

Transcription factor. Inhibits cell proliferation by activating either CDKN1A/p21 transcription or RB1 transcription. ; [Isoform 1]: Binds CDKN1A promoter and activates its transcription; this activity is

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	423 → 445	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	395 → 417	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	563 → 585	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	535 → 557	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	451 → 473	Zinc finger, C2H2 type	Domain
PF00651	BTB	15 → 121	BTB/POZ domain	Domain
PF13912	zf-C2H2_6	506 → 532		Domain
PF13912	zf-C2H2_6	479 → 503		Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in normal epidermis and in other epithelial tissues, including in colon and lung. Tends to be down-regulated in colon, lung and skin cancer tissues. {ECO:0000269|PubMed:25245946}.

Sequence

MDPVATHSCHLLQQLHEQRIQGLLCDCMLVVKGVCFKAHKNVLAAFSQYFRSLFQNSSSQ
KNDVFHLDVKNVSGIGQILDFMYTSHLDLNQDNIQVMLDTAQCLQVQNVLSLCHTFLKSA
TVVQPPGMPCNSTLSLQSTLTPDATCVISENYPPHLLQECSADAQQNKTLDESHPHASPS
VNRHHSAGEISKQAPDTSDGSCTELPFKQPNYYYKLRNFYSKQYHKHAAGPSQERVVEQP
FAFSTSTDLTTVESQPCAVSHSECILESPEHLPSNFLAQPVNDSAPHPESDATCQQPVKQ
MRLKKAIHLKKLNFLKSQKYAEQVSEPKSDDGLTKRLESASKNTLEKASSQSAEEKESEE
VVSCENFNCISETERPEDPAALEDQSQTLQSQRQYACELCGKPFKHPSNLELHKRSHTGE
KPFECNICGKHFSQAGNLQTHLRRHSGEKPYICEICGKRFAASGDVQRHIIIHSGEKPHL
CDICGRGFSNFSNLKEHKKTHTADKVFTCDECGKSFNMQRKLVKHRIRHTGERPYSCSAC
GKCFGGSGDLRRHVRTHTGEKPYTCEICNKCFTRSAVLRRHKKMHCKAGDESPDVLEELS
QAIETSDLEKSQSSDSFSQDTSVTLMPVSVKLPVHPVENSVAEFDSHSGGSYCKLRSMIQ
PHGVSDQEKLSLDPGKLAKPQMQQTQPQAYAYSDVDTPAGGEPLQADGMAMIRSSLAALD
NHGGDPLGSRASSTTYRNSEGQFFSSMTLWGLAMKTLQNENELDQ

Sequence length

765

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (11)
Acute myeloid leukemia	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24349560, 39596218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25245946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	25245946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with ZBTB49 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for ZBTB49.

Diseases Linked via Similar Genes Diseases curated for genes most similar to ZBTB49 (see Related Genes above), that are NOT already directly curated for ZBTB49 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to ZBTB49.

ZBTB49 (zinc finger and BTB domain containing 49)

Save This Analysis