ZBTB32 (zinc finger and BTB domain containing 32)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 27033
• Gene name: Zinc finger and BTB domain containing 32
• Gene symbol: ZBTB32
• Synonyms (NCBI Gene): FAXF, FAZF, Rog, TZFP, ZNF538, mynn
• Chromosome: 19
• Chromosome location: 19q13.12

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019205	hsa-miR-335-5p	Microarray	18185580
MIRT1502282	hsa-miR-1269	CLIP-seq
MIRT1502283	hsa-miR-1269b	CLIP-seq
MIRT1502284	hsa-miR-4529-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	10572087
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	10572087
GO:0001817	Process	Regulation of cytokine production	IBA
GO:0002682	Process	Regulation of immune system process	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0005515	Function	Protein binding	IPI	16189514, 19447967, 20211142, 23088713
GO:0005634	Component	Nucleus	IDA	10572087
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 605859
• HGNC: 16763
• e!Ensembl: ENSG00000011590

Protein

• UniProt ID: Q9Y2Y4
• Protein name: Zinc finger and BTB domain-containing protein 32 (FANCC-interacting protein) (Fanconi anemia zinc finger protein) (Testis zinc finger protein) (Zinc finger protein 538)
• Protein function: DNA-binding protein that binds to the to a 5'-TGTACAGTGT-3' core sequence. May function as a transcriptional transactivator and transcriptional repressor. Probably exerts its repressor effect by preventing GATA3 from binding to DNA. May play a r
• PDB: 3M5B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	373 → 395	Zinc finger, C2H2 type	Domain
  PF00651	BTB	21 → 113	BTB/POZ domain	Domain
  PF12874	zf-met	428 → 451		Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in testis. Some isoforms are ubiquitously expressed. {ECO:0000269|PubMed:10544010}.
• Sequence:

  MSLPPIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQLGRRGQW
  ALGEGISPSTFAQLLNFVYGESVELQPGELRPLQEAARALGVQSLEEACWRARGDRAKKP
  DPGLKKHQEEPEKPSRNPERELGDPGEKQKPEQVSRTGGREQEMLHKHSPPRGRPEMAGA
  TQEAQQEQTRSKEKRLQAPVGQRGADGKHGVLTWLRENPGGSEESLRKLPGPLPPAGSLQ
  TSVTPRPSWAEAPWLVGGQPALWSILLMPPRYGIPFYHSTPTTGAWQEVWREQRIPLSLN
  APKGLWSQNQLASSSPTPGSLPQGPAQLSPGEMEESDQGHTGALATCAGHEDKAGCPPRP
  HPPPAPPARSRPYACSVCGKRFSLKHQMETHYRVHTGEKPFSCSLCPQRSRDFSAMTKHL
  RTHGAAPYRCSLCGAGCPSLASMQAHMRGHSPSQLPPGWTIRSTFLYSSSRPSRPSTSPC
  CPSSSTT

• Sequence length: 487

Related Genes

No strongly related genes found yet for ZBTB32.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ZBTB32.