ZBTB14 (zinc finger and BTB domain containing 14)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7541
• Gene name: Zinc finger and BTB domain containing 14
• Gene symbol: ZBTB14
• Synonyms (NCBI Gene): ZF5, ZFP-161, ZFP-5, ZFP161, ZNF478
• Chromosome: 18
• Chromosome location: 18p11.31

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019661	hsa-miR-378a-3p	Sequencing	20371350
MIRT024497	hsa-miR-215-5p	Microarray	19074876
MIRT026260	hsa-miR-192-5p	Microarray	19074876

Gene ontology (GO) Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	8367294
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	17714511
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001817	Process	Regulation of cytokine production	IBA
GO:0001822	Process	Kidney development	IEA
GO:0002682	Process	Regulation of immune system process	IBA
GO:0003170	Process	Heart valve development	IEA
GO:0003279	Process	Cardiac septum development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	17714511
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	15629158, 25416956, 29892012, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	15629158, 17714511
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9177479
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016235	Component	Aggresome	IDA
GO:0043565	Function	Sequence-specific DNA binding	IDA	17714511
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	17714511
GO:0046872	Function	Metal ion binding	IEA
GO:0060976	Process	Coronary vasculature development	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 602126
• HGNC: 12860
• e!Ensembl: ENSG00000198081

Protein

• UniProt ID: O43829
• Protein name: Zinc finger and BTB domain-containing protein 14 (Zinc finger protein 161 homolog) (Zfp-161) (Zinc finger protein 478) (Zinc finger protein 5 homolog) (ZF5) (Zfp-5) (hZF5)
• Protein function: Transcriptional activator of the dopamine transporter (DAT), binding it's promoter at the consensus sequence 5'-CCTGCACAGTTCACGGA-3'. Binds to 5'-d(GCC)(n)-3' trinucleotide repeats in promoter regions and acts as a repressor of the FMR1 gene. Tr
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	333 → 355	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	305 → 327	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	361 → 383	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	389 → 412	Zinc finger, C2H2 type	Domain
  PF00651	BTB	26 → 132	BTB/POZ domain	Domain

• Sequence:

  MEFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDVKFRAHRCVLAACSTY
  FKKLFKKLEVDSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFL
  DKLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSPSDDTVEG
  TPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQALT
  FNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHT
  ADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERP
  FACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTP
  SAIQSETEQLQAAAMAAEAEQQLETIACS

• Sequence length: 449

Related Genes

No strongly related genes found yet for ZBTB14.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ZBTB14.