ZBED2 (zinc finger BED-type containing 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79413
• Gene name: Zinc finger BED-type containing 2
• Gene symbol: ZBED2
• Synonyms (NCBI Gene): -
• Chromosome: 3
• Chromosome location: 3q13.13

miRNA Show/Hide all (38)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017135	hsa-miR-335-5p	Microarray	18185580
MIRT530180	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT530179	hsa-miR-451b	PAR-CLIP	22012620
MIRT530178	hsa-miR-4502	PAR-CLIP	22012620
MIRT530177	hsa-miR-494-3p	PAR-CLIP	22012620
MIRT530176	hsa-miR-889-3p	PAR-CLIP	22012620
MIRT530180	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT530179	hsa-miR-451b	PAR-CLIP	22012620
MIRT530178	hsa-miR-4502	PAR-CLIP	22012620
MIRT530177	hsa-miR-494-3p	PAR-CLIP	22012620
MIRT530176	hsa-miR-889-3p	PAR-CLIP	22012620
MIRT1501749	hsa-miR-4698	CLIP-seq
MIRT1501750	hsa-miR-494	CLIP-seq
MIRT1501751	hsa-miR-548p	CLIP-seq
MIRT1501752	hsa-miR-606	CLIP-seq
MIRT1501753	hsa-miR-889	CLIP-seq
MIRT1501750	hsa-miR-494	CLIP-seq
MIRT1501753	hsa-miR-889	CLIP-seq
MIRT1501750	hsa-miR-494	CLIP-seq
MIRT1501753	hsa-miR-889	CLIP-seq
MIRT1501750	hsa-miR-494	CLIP-seq
MIRT1501753	hsa-miR-889	CLIP-seq
MIRT2371398	hsa-miR-371b-5p	CLIP-seq
MIRT2371399	hsa-miR-4687-5p	CLIP-seq
MIRT2371400	hsa-miR-4690-3p	CLIP-seq
MIRT1501749	hsa-miR-4698	CLIP-seq
MIRT1501750	hsa-miR-494	CLIP-seq
MIRT1501753	hsa-miR-889	CLIP-seq
MIRT1501750	hsa-miR-494	CLIP-seq
MIRT1501753	hsa-miR-889	CLIP-seq
MIRT1501750	hsa-miR-494	CLIP-seq
MIRT1501753	hsa-miR-889	CLIP-seq
MIRT2664763	hsa-miR-3622a-5p	CLIP-seq
MIRT2664764	hsa-miR-4267	CLIP-seq
MIRT2664765	hsa-miR-4423-3p	CLIP-seq
MIRT2664763	hsa-miR-3622a-5p	CLIP-seq
MIRT2664764	hsa-miR-4267	CLIP-seq
MIRT2664765	hsa-miR-4423-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	32385160
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	32385160
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	32385160
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	32385160
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IC	32385160
GO:0005634	Component	Nucleus	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0045618	Process	Positive regulation of keratinocyte differentiation	IMP	31552090
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 615246
• HGNC: 20710
• e!Ensembl: ENSG00000177494

Protein

• UniProt ID: Q9BTP6
• Protein name: Zinc finger BED domain-containing protein 2
• Protein function: Transcriptional regulator which has intrinsic repressor activity and which competes with the transcriptional activator IRF1 for binding to the 5'-[CA]GAA[AC]C[CT]-3' consensus sequence in gene promoters (PubMed:32385160). May thereby play a role
• PDB: 2DJR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02892	zf-BED	55 → 107	BED zinc finger	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in keratinocytes. {ECO:0000269|PubMed:31552090}.
• Sequence:

  MMRREDEEEEGTMMKAKGDLEMKEEEEISETGELVGPFVSAMPTPMPHNKGTRFSEAWEY
  FHLAPARAGHHPNQYATCRLCGRQVSRGPGVNVGTTALWKHLKSMHREELEKSGHGQAGQ
  RQDPRPHGPQLPTGIEGNWGRLLEQVGTMALWASQREKEVLRRERAVEWRERAVEKRERA
  LEEVERAILEMKWKVRAEKEACQREKELPAAVHPFHFV

• Sequence length: 218

Related Genes

No strongly related genes found yet for ZBED2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ZBED2.