ZBED10P (zinc finger BED-type containing 10, pseudogene)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 113763
Gene name Zinc finger BED-type containing 10, pseudogene
Gene symbol ZBED10P
Synonyms (NCBI Gene)
C7orf29ZBED6CL
Chromosome 7
Chromosome location 7q36.1
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT021979 hsa-miR-128-3p Microarray 17612493
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
615252 21720 HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96FA7
Protein name Putative protein ZBED10P (ZBED6 C-terminal-like protein) (zinc finger BED-type containing 10 pseudogene)
Family and domains
Sequence 
MVVREASAAQASLSQVLPQLRYLHIFLEQVHTHFQEQSVGERGAAIQLAEGLARQLCTDC
QLNKLFYREEFVLATLLDPCFKGKIEAILPWGPTDIDHWKQVLVYKVKEIRVSEYSLNSP
SPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSHSGAFLLAQREKGLLESMGLLASER
SGGSLSTKSHWASIIVKKYLWENETVGAQDDPLAYWEKKREAWPPSICLTPHRSLL
Sequence length 236
Interactions View interactions

No strongly related genes found yet for ZBED10P.

No additional diseases found yet through genes similar to ZBED10P.