ZAR1 (zygote arrest 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 326340
• Gene name: Zygote arrest 1
• Gene symbol: ZAR1
• Synonyms (NCBI Gene): Z3CXXC6
• Chromosome: 4
• Chromosome location: 4p11
• Summary: This maternal effect gene is oocyte-specific and encodes a protein that is thought to function in the initiation of embryogenesis. A similar protein in mouse is required for female fertility. [provided by RefSeq, Jul 2013]

miRNA Show/Hide all (7)

miRTarBase ID	miRNA	Experiments	Reference
MIRT2150807	hsa-miR-3119	CLIP-seq
MIRT2150808	hsa-miR-3942-3p	CLIP-seq
MIRT2150809	hsa-miR-4493	CLIP-seq
MIRT2150807	hsa-miR-3119	CLIP-seq
MIRT2150809	hsa-miR-4493	CLIP-seq
MIRT2150807	hsa-miR-3119	CLIP-seq
MIRT2150809	hsa-miR-4493	CLIP-seq

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001556	Process	Oocyte maturation	ISS	31598710, 36264786
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	ISS	31598710, 36264786
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS	20014101
GO:0006412	Process	Translation	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0017148	Process	Negative regulation of translation	IEA
GO:0017148	Process	Negative regulation of translation	ISS	36264786
GO:0030154	Process	Cell differentiation	IEA
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IEA
GO:0043232	Component	Intracellular membraneless organelle	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048255	Process	MRNA stabilization	ISS	36264786
GO:0048477	Process	Oogenesis	IEA
GO:0140610	Function	RNA sequestering activity	ISS	36264786
GO:0140693	Function	Molecular condensate scaffold activity	ISS	36264786
GO:0140694	Process	Membraneless organelle assembly	ISS	36264786

Other IDs

• MIM: 607520
• HGNC: 20436
• e!Ensembl: ENSG00000182223

Protein

• UniProt ID: Q86SH2
• Protein name: Zygote arrest protein 1
• Protein function: mRNA-binding protein that mediates formation of MARDO (mitochondria-associated ribonucleoprotein domain), a membraneless compartment that stores maternal mRNAs in oocytes. MARDO assembly around mitochondria is directed by an increase in mitochon
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13695	zf-3CxxC	325 → 410	Zinc-binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ovary and testis. {ECO:0000269|PubMed:12539046}.
• Sequence:

  MAALGDEVLDGYVFPACPPCSYRYPYPAATKGKGAAGGSWQQRGRGCLPASSPCSAGAAS
  LSFPGCGRLTAAEYFDSYQRERLMALLAQVGPGLGPRARRAGSCDVAVQVSPRIDAAVQC
  SLGRRTLQRRARDPESPAGPGAEGTTGGGSFSQQPSRRGLEQGSPQNGAPRPMRFPRTVA
  VYSPLALRRLTAFLEGPGPAAGEQRSGASDGERGPPPARLQGPEEGEVWTKKAPRRPQSD
  DDGEAQAAVRASWEQPADGPELPPREAQEGEAAPRSALRSPGQPPSAGRARDGGDGREAA
  VAGEGPSPRSPELGKERLRFQFLEQKYGYYHCKDCNIRWESAYVWCVQGTNKVYFKQFCR
  TCQKSYNPYRVEDITCQSCKQTRCSCPVKLRHVDPKRPHRQDLCGRCKGKRLSCDSTFSF
  KYII

• Sequence length: 424

Related Genes

No strongly related genes found yet for ZAR1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ZAR1.