Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	55702
Gene name	YJU2 splicing factor homolog
Gene symbol	YJU2
Synonyms (NCBI Gene)	CCDC94
Chromosome	19
Chromosome location	19p13.3

14 Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000349	Process	Generation of catalytic spliceosome for first transesterification step	IEA
GO:0000398	Process	MRNA splicing, via spliceosome	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 27107012, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005681	Component	Spliceosomal complex	IEA
GO:0006397	Process	MRNA processing	IEA
GO:0008380	Process	RNA splicing	IBA
GO:0008380	Process	RNA splicing	IEA
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0071006	Component	U2-type catalytic step 1 spliceosome	IBA
GO:0071006	Component	U2-type catalytic step 1 spliceosome	IDA	29301961
GO:0071006	Component	U2-type catalytic step 1 spliceosome	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9BW85

Protein name

Splicing factor YJU2 (Coiled-coil domain-containing protein 94)

Protein function

Part of the spliceosome which catalyzes two sequential transesterification reactions, first the excision of the non-coding intron from pre-mRNA and then the ligation of the coding exons to form the mature mRNA (PubMed:29301961). Plays a role in

PDB

5YZG , 6ZYM , 7A5P , 8I0W

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04502	DUF572	9 → 318	Family of unknown function (DUF572)	Family

Sequence

MSERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARK
ETVQNEVYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQAEKLLEEEEKR
VQKEREDEELNNPMKVLENRTKDSKLEMEVLENLQELKDLNQRQAHVDFEAMLRQHRLSE
EERRRQQQEEDEQETAALLEEARKRRLLEDSDSEDEAAPSPLQPALRPNPTAILDEAPKP
KRKVEVWEQSVGSLGSRPPLSRLVVVKKAKADPDCSNGQPQAAPTPGAPQNRKEANPTPL
TPGASSLSQLGAYLDSDDSNGSN

Sequence length

323

Interactions

View interactions

Related Genes Genes most often co-reported with YJU2 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for YJU2.

Diseases Linked via Similar Genes Diseases curated for genes most similar to YJU2 (see Related Genes above), that are NOT already directly curated for YJU2 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to YJU2.

YJU2 (YJU2 splicing factor homolog)

Bookmark This Gene