YAE1 (YAE1 maturation factor of ABCE1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 57002
Gene name YAE1 maturation factor of ABCE1
Gene symbol YAE1
Synonyms (NCBI Gene)
C7orf36CIAB2GK003YAE1D1
Chromosome 7
Chromosome location 7p14.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0051604 Process Protein maturation IDA 26182403
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NRH1
Protein name Protein YAE1 homolog (Yae1 domain-containing protein 1)
Protein function The complex LTO1:YAE1 functions as a target specific adapter that probably recruits apo-ABCE1 to the cytosolic iron-sulfur protein assembly (CIA) complex machinery (PubMed:26182403). May be required for biogenesis of the large ribosomal subunit
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09811 Yae1_N 45 → 83 Essential protein Yae1, N terminal Family
Sequence 
MSWVQAASLIQGPGDKGDVFDEEADESLLAQREWQSNMQRRVKEGYRDGIDAGKAVTLQQ
GFNQGYKKGAEVILNYGRLRGTLSALLSWCHLHNNNSTLINKINNLLDAVGQCEEYVLKH
LKSITPPSHVVDLLDSIEDMDLCHVVPAEKKIDEAKDERLCENNAEFNKNCSKSHSGIDC
SYVECCRTQEHAHSENPSPTWILEQTASLVKQLGLSVDVLQHLKQL
Sequence length 226
Interactions View interactions

No strongly related genes found yet for YAE1.

No additional diseases found yet through genes similar to YAE1.