XKRY (XK related, Y-linked (pseudogene)) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	9082
Gene name	XK related, Y-linked (pseudogene)
Gene symbol	XKRY
Synonyms (NCBI Gene)	XKRY1
Chromosome	Y
Chromosome location	Yq11.222
Summary	This probable pseudogene is located in the nonrecombining portion of the Y chromosome, and is expressed specifically in testis. It is similar to the XK (X-linked Kell blood group precursor) gene, which encodes a putative membrane transport protein. This g

8 Show/Hide all (8)

miRTarBase ID	miRNA	Experiments	Reference
MIRT2149355	hsa-miR-103a	CLIP-seq
MIRT2149356	hsa-miR-107	CLIP-seq
MIRT2149357	hsa-miR-4661-5p	CLIP-seq
MIRT2149358	hsa-miR-885-3p	CLIP-seq
MIRT2369819	hsa-miR-514	CLIP-seq
MIRT2369820	hsa-miR-514b-3p	CLIP-seq
MIRT2663396	hsa-miR-590-3p	CLIP-seq
MIRT2663397	hsa-miR-606	CLIP-seq

2

GO ID	Ontology	Definition	Evidence	Reference
GO:0007338	Process	Single fertilization	TAS	9381176
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
400015	18571	ENSG00000290724

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	O14609
Protein name	Testis-specific XK-related protein, Y-linked
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Testis specific.
Sequence	MFIFNSIADDIFPLISCVGAIHCNILAIRTGNDFAAIKLQVIKLIYLMIWHSLVIISPVV TLAFFPASLKQGSLHFLLIIYFVLLLTPWLEFSKSGTHLPSNTKIIPAWWVSMDAYLNHA SICCHQFSCLSAVKLQLSNEELIRDTRWDIQSYTTDFSF
Sequence length	159
Interactions	View interactions