XG (Xg glycoprotein (Xg blood group))

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7499
• Gene name: Xg glycoprotein (Xg blood group)
• Gene symbol: XG
• Synonyms (NCBI Gene): PBDX
• Chromosome: X
• Chromosome location: Xp22.33
• Summary: This gene encodes the XG blood group antigen, and is located at the pseudoautosomal boundary on the short (p) arm of chromosome X. The three 5` exons reside in the pseudoautosomal region and the remaining exons within the X-specific end. A truncated copy

miRNA Show/Hide all (69)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1495325	hsa-miR-197	CLIP-seq
MIRT1495326	hsa-miR-3140-5p	CLIP-seq
MIRT1495327	hsa-miR-3611	CLIP-seq
MIRT1495328	hsa-miR-3913-3p	CLIP-seq
MIRT1495329	hsa-miR-483-3p	CLIP-seq
MIRT1495330	hsa-miR-499-3p	CLIP-seq
MIRT1495331	hsa-miR-499a-3p	CLIP-seq
MIRT1495332	hsa-miR-548ac	CLIP-seq
MIRT1495333	hsa-miR-548ae	CLIP-seq
MIRT1495334	hsa-miR-548aj	CLIP-seq
MIRT1495335	hsa-miR-548am	CLIP-seq
MIRT1495336	hsa-miR-548d-3p	CLIP-seq
MIRT1495337	hsa-miR-548x	CLIP-seq
MIRT1495338	hsa-miR-548z	CLIP-seq
MIRT1495339	hsa-miR-758	CLIP-seq
MIRT1495340	hsa-let-7a	CLIP-seq
MIRT1495341	hsa-let-7b	CLIP-seq
MIRT1495342	hsa-let-7c	CLIP-seq
MIRT1495343	hsa-let-7d	CLIP-seq
MIRT1495344	hsa-let-7e	CLIP-seq
MIRT1495345	hsa-let-7f	CLIP-seq
MIRT1495346	hsa-let-7g	CLIP-seq
MIRT1495347	hsa-let-7i	CLIP-seq
MIRT1495348	hsa-miR-1207-3p	CLIP-seq
MIRT1495349	hsa-miR-202	CLIP-seq
MIRT1495350	hsa-miR-3119	CLIP-seq
MIRT1495351	hsa-miR-3156-5p	CLIP-seq
MIRT1495352	hsa-miR-3650	CLIP-seq
MIRT1495353	hsa-miR-3922-5p	CLIP-seq
MIRT1495354	hsa-miR-4458	CLIP-seq
MIRT1495355	hsa-miR-4500	CLIP-seq
MIRT1495356	hsa-miR-4699-5p	CLIP-seq
MIRT1495357	hsa-miR-4718	CLIP-seq
MIRT1495358	hsa-miR-562	CLIP-seq
MIRT1495359	hsa-miR-767-5p	CLIP-seq
MIRT1495360	hsa-miR-98	CLIP-seq
MIRT1495325	hsa-miR-197	CLIP-seq
MIRT1495326	hsa-miR-3140-5p	CLIP-seq
MIRT1495328	hsa-miR-3913-3p	CLIP-seq
MIRT2149224	hsa-miR-4659a-3p	CLIP-seq
MIRT2149225	hsa-miR-4659b-3p	CLIP-seq
MIRT1495329	hsa-miR-483-3p	CLIP-seq
MIRT1495330	hsa-miR-499-3p	CLIP-seq
MIRT1495331	hsa-miR-499a-3p	CLIP-seq
MIRT1495332	hsa-miR-548ac	CLIP-seq
MIRT1495336	hsa-miR-548d-3p	CLIP-seq
MIRT1495338	hsa-miR-548z	CLIP-seq
MIRT2369680	hsa-miR-3143	CLIP-seq
MIRT2369681	hsa-miR-4704-3p	CLIP-seq
MIRT2663330	hsa-miR-1257	CLIP-seq
MIRT2663331	hsa-miR-1283	CLIP-seq
MIRT2663332	hsa-miR-371-5p	CLIP-seq
MIRT2663333	hsa-miR-371b-5p	CLIP-seq
MIRT2663334	hsa-miR-4263	CLIP-seq
MIRT2663335	hsa-miR-4286	CLIP-seq
MIRT2663336	hsa-miR-4311	CLIP-seq
MIRT2663337	hsa-miR-4768-5p	CLIP-seq
MIRT2663338	hsa-miR-4786-5p	CLIP-seq
MIRT2663339	hsa-miR-4797-5p	CLIP-seq
MIRT2663340	hsa-miR-4799-5p	CLIP-seq
MIRT2663341	hsa-miR-501-5p	CLIP-seq
MIRT2663342	hsa-miR-513c	CLIP-seq
MIRT2663343	hsa-miR-514b-5p	CLIP-seq
MIRT2663344	hsa-miR-548c-3p	CLIP-seq
MIRT2663345	hsa-miR-548p	CLIP-seq
MIRT2663346	hsa-miR-548u	CLIP-seq
MIRT2663347	hsa-miR-576-5p	CLIP-seq
MIRT2663348	hsa-miR-578	CLIP-seq
MIRT2663349	hsa-miR-769-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	7533029
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0034109	Process	Homotypic cell-cell adhesion	IBA
GO:0072683	Process	T cell extravasation	IBA
GO:2000391	Process	Positive regulation of neutrophil extravasation	IBA

Other IDs

• MIM: 300879
• HGNC: 12806
• e!Ensembl: ENSG00000124343

Protein

• UniProt ID: P55808
• Protein name: Glycoprotein Xg (Protein PBDX)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12301	CD99L2	25 → 180	CD99 antigen like protein 2	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in erythroid tissues, including thymus, bone marrow and fetal liver, and in several nonerythroid tissues, such as heart, placenta, skeletal muscle, thyroid and trachea, as well as in skin fibroblasts. Expression is low or und
• Sequence:

  MESWWGLPCLAFLCFLMHARGQRDFDLADALDDPEPTKKPNSDIYPKPKPPYYPQPENPD
  SGGNIYPRPKPRPQPQPGNSGNSGGYFNDVDRDDGRYPPRPRPRPPAGGGGGGYSSYGNS
  DNTHGGDHHSTYGNPEGNMVAKIVSPIVSVVVVTLLGAAASYFKLNNRRNCFRTHEPENV
  

• Sequence length: 180

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (6)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Cervical cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Albinism Ocular	Ocular albinism	Pubtator	8301646	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24349560	Associate	★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	7180850	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for XG.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to XG.