Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	6846
Gene name	X-C motif chemokine ligand 2
Gene symbol	XCL2
Synonyms (NCBI Gene)	SCM-1bSCM1BSCYC2
Chromosome	1
Chromosome location	1q24.2

20 Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 28381538, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	7875320
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	7875320
GO:0008015	Process	Blood circulation	TAS	7875320
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0048020	Function	CCR chemokine receptor binding	IBA
GO:0060326	Process	Cell chemotaxis	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA

MIM	HGNC	e!Ensembl
604828	10646	ENSG00000143185

Q9UBD3

Protein name

Cytokine SCM-1 beta (C motif chemokine 2) (XC chemokine ligand 2)

Protein function

Chemotactic activity for lymphocytes but not for monocytes or neutrophils.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00048	IL8	30 → 84	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

Sequence

MRLLILALLGICSLTAYIVEGVGSEVSHRRTCVSLTTQRLPVSRIKTYTITEGSLRAVIF
ITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Sequence length

114

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Cytokine-cytokine receptor interaction	Chemokine receptors bind chemokines
Viral protein interaction with cytokine and cytokine receptor	G alpha (q) signalling events
Chemokine signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (14)
BASAL CELL CARCINOMA	—	GWAS catalog	38182794	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BELL'S PALSY	—	GWAS catalog	33602968	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	31904872	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DRY EYE SYNDROME	—	GWAS catalog	40465716	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	31904872	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	28604730, 39366959	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	28604730, 39366959	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	28604730, 39366959	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA	—	GWAS catalog	34594039	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	34927100, 40021644	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	28604730, 39366959	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	28604730	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	33667223	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (13)
Breast Neoplasms	Breast neoplasm	Pubtator	24172169, 36046784	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	40536885	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27156946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22134506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27156946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27156946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27156946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37305390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	31983065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31801909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27919438	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	LHGDN	17763208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigoid Benign Mucous Membrane	Benign mucous membrane pemphigoid	Pubtator	37690517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ABHD8	2	["Estrogen-receptor negative breast cancer","Upper aerodigestive tract neoplasm"]	0	[]	3	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Upper aerodigestive tract neoplasm)"]
ANKLE1	2	["Estrogen-receptor negative breast cancer","Upper aerodigestive tract neoplasm"]	0	[]	3	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Upper aerodigestive tract neoplasm)"]
SC5D	2	["Bell's palsy","Estrogen-receptor negative breast cancer"]	0	[]	2	["GWAS catalog (Bell's palsy)","GWAS catalog (Estrogen-receptor negative breast cancer)"]
XCL1	1	["Estrogen-receptor negative breast cancer"]	5	["Cytokine-cytokine receptor interaction","Viral protein interaction with cytokine and cytokine receptor","Chemokine signaling pathway","G alpha (q) signalling events","Chemokine receptors bind chemokines"]	1	["GWAS catalog (Estrogen-receptor negative breast cancer)"]
XCR1	0	[]	5	["Cytokine-cytokine receptor interaction","Viral protein interaction with cytokine and cytokine receptor","Chemokine signaling pathway","G alpha (q) signalling events","Chemokine receptors bind chemokines"]	0	[]

XCL2 (X-C motif chemokine ligand 2)

Bookmark This Gene