WT1-AS (WT1 antisense RNA)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 51352 |
| Gene name | WT1 antisense RNA |
| Gene symbol | WT1-AS |
| Synonyms (NCBI Gene) |
WIT-1WIT1WT1-AS1WT1AS
|
| Chromosome | 11 |
| Chromosome location | 11p13 |
| Summary | This gene is located upstream of the Wilms tumor 1 (WT1) gene; these two genes are bi-directionally transcribed from the same promoter region. This gene is imprinted in kidney, with preferential expression from the paternal allele. Imprinting defects at c |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
|
|||||||||||
|
|||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q06250 |
| Protein name | Putative Wilms tumor upstream neighbor 1 gene protein (WIT-1) (Wilms tumor-associated antisense RNA) |
| Family and domains | |
| Sequence |
MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHL |
| Sequence length | 92 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with WT1-AS across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to WT1-AS (see Related Genes above), that are NOT already directly curated for WT1-AS itself -- a lead worth checking, not a confirmed association.
0
|
|