WRAP73 (WD repeat containing, antisense to TP73)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 49856
• Gene name: WD repeat containing, antisense to TP73
• Gene symbol: WRAP73
• Synonyms (NCBI Gene): WDR8
• Chromosome: 1
• Chromosome location: 1p36.32
• Summary: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com

miRNA Show/Hide all (12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029414	hsa-miR-26b-5p	Microarray	19088304
MIRT038263	hsa-miR-361-3p	CLASH	23622248
MIRT1494023	hsa-miR-3144-3p	CLIP-seq
MIRT1494024	hsa-miR-4699-3p	CLIP-seq
MIRT1494025	hsa-miR-520d-5p	CLIP-seq
MIRT1494026	hsa-miR-524-5p	CLIP-seq
MIRT2463558	hsa-miR-139-5p	CLIP-seq
MIRT2463559	hsa-miR-4328	CLIP-seq
MIRT2463560	hsa-miR-548a-3p	CLIP-seq
MIRT2463561	hsa-miR-548e	CLIP-seq
MIRT2463562	hsa-miR-548f	CLIP-seq
MIRT2463563	hsa-miR-582-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25036637, 26545777, 26638075, 26675238, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	21399614, 26545777
GO:0005813	Component	Centrosome	IEA
GO:0005814	Component	Centriole	IEA
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005856	Component	Cytoskeleton	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0034451	Component	Centriolar satellite	IEA
GO:0036064	Component	Ciliary basal body	IDA	26545777
GO:0090307	Process	Mitotic spindle assembly	IMP	26545777
GO:1902857	Process	Positive regulation of non-motile cilium assembly	IMP	26545777
GO:1990811	Component	MWP complex	IBA

Other IDs

• MIM: 606040
• HGNC: 12759
• e!Ensembl: ENSG00000116213

Protein

• UniProt ID: Q9P2S5
• Protein name: WD repeat-containing protein WRAP73 (WD repeat-containing protein 8) (WD repeat-containing protein antisense to TP73 gene)
• Protein function: The SSX2IP:WRAP73 complex is proposed to act as regulator of spindle anchoring at the mitotic centrosome. Required for the centrosomal localization of SSX2IP and normal mitotic bipolar spindle morphology (PubMed:26545777). Required for the targe
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00400	WD40	211 → 251	WD domain, G-beta repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Predominant expression in heart, brain, liver, thymus, prostate, and testis, and barely detectable expression in lung.
• Sequence:

  MNFSEVFKLSSLLCKFSPDGKYLASCVQYRLVVRDVNTLQILQLYTCLDQIQHIEWSADS
  LFILCAMYKRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTEFHLRITVWS
  LCTKSVSYIKYPKACLQGITFTRDGRYMALAERRDCKDYVSIFVCSDWQLLRHFDTDTQD
  LTGIEWAPNGCVLAVWDTCLEYKILLYSLDGRLLSTYSAYEWSLGIKSVAWSPSSQFLAV
  GSYDGKVRILNHVTWKMITEFGHPAAINDPKIVVYKEAEKSPQLGLGCLSFPPPRAGAGP
  LPSSESKYEIASVPVSLQTLKPVTDRANPKIGIGMLAFSPDSYFLATRNDNIPNAVWVWD
  IQKLRLFAVLEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQVPGEGDFAVLS
  LCWHLSGDSMALLSKDHFCLCFLETEAVVGTACRQLGGHT

• Sequence length: 460

Related Genes

No strongly related genes found yet for WRAP73.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to WRAP73.