WHAMMP3 (WHAMM pseudogene 3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 339005
Gene name WHAMM pseudogene 3
Gene symbol WHAMMP3
Synonyms (NCBI Gene)
WHAMML1WHDC1L1
Chromosome 15
Chromosome location 15q11.2
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT028981 hsa-miR-26b-5p Microarray 19088304
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 27892 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q1A5X7
Protein name Putative WASP homolog-associated protein with actin, membranes and microtubules-like protein 1 (WAS protein homolog associated with actin, Golgi membranes and microtubules pseudogene 3) (WAS protein homology region 2 domain-containing protein 1-like prote
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15871 JMY 27 → 153 Junction-mediating and -regulatory protein Family
Sequence 
MMILVFWSNYPYEPVCLASHRNNMEASVPKYKKHLPQLGMQKEMEQDVKRFGQAAWATAI
PRLEKLKLMLAQETLQLMRAKELCLNHKRAEIQGKMEDLPEQEKNINVVDELAIQFYEIQ
LELYEVKFEILKNKEILLTTQLDSLERLIKDEI
Sequence length 153
Interactions View interactions

No strongly related genes found yet for WHAMMP3.

No additional diseases found yet through genes similar to WHAMMP3.