WFIKKN1 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 117166
• Gene name: WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1
• Gene symbol: WFIKKN1
• Synonyms (NCBI Gene): C16orf12, RJD2, WFDC20A, WFIKKN
• Chromosome: 16
• Chromosome location: 16p13.3
• Summary: This gene encodes a secreted multidomain protein consisting of a signal peptide, a WAP domain, a follistatin domain, an immunoglobulin domain, two tandem Kunitz domains, and an NTR domain. These domains have been implicated frequently in inhibition of var

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018813	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001501	Process	Skeletal system development	IEA
GO:0004857	Function	Enzyme inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	18596030, 23829672, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IBA
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IDA	21054789
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0048019	Function	Receptor antagonist activity	IBA
GO:0048019	Function	Receptor antagonist activity	IDA	21054789
GO:0048019	Function	Receptor antagonist activity	IEA
GO:0050431	Function	Transforming growth factor beta binding	IBA
GO:0050431	Function	Transforming growth factor beta binding	IDA	21054789
GO:0050431	Function	Transforming growth factor beta binding	IEA
GO:0055001	Process	Muscle cell development	IEA
GO:0060021	Process	Roof of mouth development	IEA

Other IDs

• MIM: 608021
• HGNC: 30912
• e!Ensembl: ENSG00000127578

Protein

• UniProt ID: Q96NZ8
• Protein name: WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 (Growth and differentiation factor-associated serum protein 2) (GASP-2) (hGASP-2) (WAP, follistatin, immunoglobulin, Kunitz and NTR domain-containing protein)
• Protein function: Protease-inhibitor that contains multiple distinct protease inhibitor domains. Probably has serine protease- and metalloprotease-inhibitor activity (By similarity).
• PDB: 2DDI , 2DDJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00014	Kunitz_BPTI	358 → 410	Kunitz/Bovine pancreatic trypsin inhibitor domain	Domain
  PF00014	Kunitz_BPTI	299 → 352	Kunitz/Bovine pancreatic trypsin inhibitor domain	Domain
  PF00095	WAP	29 → 78		Domain
  PF13927	Ig_3	185 → 267		Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in pancreas, kidney, liver, placenta, and lung.
• Sequence:

  MPALRPLLPLLLLLRLTSGAGLLPGLGSHPGVCPNQLSPNLWVDAQSTCERECSRDQDCA
  AAEKCCINVCGLHSCVAARFPGSPAAPTTAASCEGFVCPQQGSDCDIWDGQPVCRCRDRC
  EKEPSFTCASDGLTYYNRCYMDAEACLRGLHLHIVPCKHVLSWPPSSPGPPETTARPTPG
  AAPVPPALYSSPSPQAVQVGGTASLHCDVSGRPPPAVTWEKQSHQRENLIMRPDQMYGNV
  VVTSIGQLVLYNARPEDAGLYTCTARNAAGLLRADFPLSVVQREPARDAAPSIPAPAECL
  PDVQACTGPTSPHLVLWHYDPQRGGCMTFPARGCDGAARGFETYEACQQACARGPGDACV
  LPAVQGPCRGWEPRWAYSPLLQQCHPFVYGGCEGNGNNFHSRESCEDACPVPRTPPCRAC
  RLRSKLALSLCRSDFAIVGRLTEVLEEPEAAGGIARVALEDVLKDDKMGLKFLGTKYLEV
  TLSGMDWACPCPNMTAGDGPLVIMGEVRDGVAVLDAGSYVRAASEKRVKKILELLEKQAC
  ELLNRFQD

• Sequence length: 548

Related Genes

No strongly related genes found yet for WFIKKN1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to WFIKKN1.