WFDC9 (WAP four-disulfide core domain 9)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 259240
Gene name WAP four-disulfide core domain 9
Gene symbol WFDC9
Synonyms (NCBI Gene)
WAP9dJ688G8.2
Chromosome 20
Chromosome location 20q13.12
Summary The WAP-type four-disulfide core (WFDC) domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many members of the WFDC domain family. This gene encodes a
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004867 Function Serine-type endopeptidase inhibitor activity IBA
GO:0005515 Function Protein binding IPI 25416956
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0019731 Process Antibacterial humoral response IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NEX5
Protein name Protein WFDC9
Family and domains
Sequence 
MKPWILLLVMFISGVVMLLPVLGSFWNKDPFLDMIRETEQCWVQPPYKYCEKRCTKIMTC
VRPNHTCCWTYCGNICLDNEEPLKSMLNP
Sequence length 89
Interactions View interactions

No strongly related genes found yet for WFDC9.

No additional diseases found yet through genes similar to WFDC9.