WFDC3 (WAP four-disulfide core domain 3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 140686
Gene name WAP four-disulfide core domain 3
Gene symbol WFDC3
Synonyms (NCBI Gene)
WAP14dJ447F3.3
Chromosome 20
Chromosome location 20q13.12
Summary This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. The enco
miRNA miRNA information provided by mirtarbase database.
8 Show/Hide all (8)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018314 hsa-miR-335-5p Microarray 18185580
MIRT1492341 hsa-miR-29a CLIP-seq
MIRT1492342 hsa-miR-29b CLIP-seq
MIRT1492343 hsa-miR-29c CLIP-seq
MIRT1492344 hsa-miR-329 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004867 Function Serine-type endopeptidase inhibitor activity IBA
GO:0004867 Function Serine-type endopeptidase inhibitor activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IUB2
Protein name WAP four-disulfide core domain protein 3 (Putative protease inhibitor WAP14)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00095 WAP 166 → 206 Domain
PF00095 WAP 29 → 68 Domain
PF00095 WAP 72 → 113 Domain
PF00095 WAP 123 → 160 Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed.
Sequence 
MMLSCLFLLKALLALGSLESWITAGEHAKEGECPPHKNPCKELCQGDELCPAEQKCCTTG
CGRICRDIPKGRKRDCPRVIRKQSCLKRCITDETCPGVKKCCTLGCNKSCVVPISKQKLA
EFGGECPADPLPCEELCDGDASCPQGHKCCSTGCGRTCLGDIEGGRGGDCPKVLVGLCIV
GCVMDENCQAGEKCCKSGCGRFCVPPVLPPKLTMNPNWTVRSDSELEIPVP
Sequence length 231
Interactions View interactions

No strongly related genes found yet for WFDC3.

No additional diseases found yet through genes similar to WFDC3.