WFDC13 (WAP four-disulfide core domain 13) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	164237
Gene name	WAP four-disulfide core domain 13
Gene symbol	WFDC13
Synonyms (NCBI Gene)	C20orf138WAP13dJ601O1.3
Chromosome	20
Chromosome location	20q13.12
Summary	This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFD

3

miRTarBase ID	miRNA	Experiments	Reference
MIRT2148427	hsa-miR-3920	CLIP-seq
MIRT2368868	hsa-miR-4738-3p	CLIP-seq
MIRT2368869	hsa-miR-548g	CLIP-seq

8 Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0019731	Process	Antibacterial humoral response	IBA
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0045087	Process	Innate immune response	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q8IUB5
Protein name	WAP four-disulfide core domain protein 13
Protein function	Putative acid-stable proteinase inhibitor.
Family and domains
Sequence	MKPVLPLQFLVVFCLALQLVPGSPKQRVLKYILEPPPCISAPENCTHLCTMQEDCEKGFQ CCSSFCGIVCSSETFQKRNRIKHKGSEVIMPAN
Sequence length	93
Interactions	View interactions