WFDC11 (WAP four-disulfide core domain 11)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 259239
Gene name WAP four-disulfide core domain 11
Gene symbol WFDC11
Synonyms (NCBI Gene)
WAP11
Chromosome 20
Chromosome location 20q13.12
Summary This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFD
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017441 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004867 Function Serine-type endopeptidase inhibitor activity IBA
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0019731 Process Antibacterial humoral response IBA
GO:0045087 Process Innate immune response IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NEX6
Protein name Protein WFDC11
Family and domains
Sequence 
MVSLMKLWIPMLMTFFCTVLLSVLGEMRKKRYDRKELLLEECWGKPNVKECTNKCSKAFR
CKDKNYTCCWTYCGNICWINVETSGDY
Sequence length 87
Interactions View interactions

No strongly related genes found yet for WFDC11.

No additional diseases found yet through genes similar to WFDC11.