WFDC10B (WAP four-disulfide core domain 10B) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	280664
Gene name	WAP four-disulfide core domain 10B
Gene symbol	WFDC10B
Synonyms (NCBI Gene)	WAP12
Chromosome	20
Chromosome location	20q13.12
Summary	This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFD

3

miRTarBase ID	miRNA	Experiments	Reference
MIRT2695230	hsa-miR-3202	CLIP-seq
MIRT2695231	hsa-miR-3917	CLIP-seq
MIRT2695232	hsa-miR-4533	CLIP-seq

7 Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0019731	Process	Antibacterial humoral response	IBA
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0045087	Process	Innate immune response	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q8IUB3
Protein name	Protein WFDC10B
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Ubiquitously expressed.
Sequence	MAPQTLLLVLVLCVLLLQAQGGYRDKMRMQRIKVCEKRPSIDLCIHHCSYFQKCETNKIC CSAFCGNICMSIL
Sequence length	73
Interactions	View interactions