WFDC10A (WAP four-disulfide core domain 10A)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 140832
Gene name WAP four-disulfide core domain 10A
Gene symbol WFDC10A
Synonyms (NCBI Gene)
C20orf146WAP10dJ688G8.3
Chromosome 20
Chromosome location 20q13.12
Summary This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFD
miRNA miRNA information provided by mirtarbase database.
6 Show/Hide all (6)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2368855 hsa-miR-138 CLIP-seq
MIRT2368856 hsa-miR-2116 CLIP-seq
MIRT2368857 hsa-miR-3164 CLIP-seq
MIRT2368858 hsa-miR-4299 CLIP-seq
MIRT2368859 hsa-miR-4677-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004867 Function Serine-type endopeptidase inhibitor activity IBA
GO:0004867 Function Serine-type endopeptidase inhibitor activity IEA
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0019731 Process Antibacterial humoral response IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H1F0
Protein name WAP four-disulfide core domain protein 10A (Putative protease inhibitor WAP10A)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00095 WAP 36 → 78 Domain
Sequence 
MAPQTLLPVLVLCVLLLQAQGGYRDKKRMQKTQLSPEIKVCQQQPKLYLCKHLCESHRDC
QANNICCSTYCGNVCMSIL
Sequence length 79
Interactions View interactions

No strongly related genes found yet for WFDC10A.

No additional diseases found yet through genes similar to WFDC10A.