WDR54 (WD repeat domain 54) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	84058
Gene name	WD repeat domain 54
Gene symbol	WDR54
Synonyms (NCBI Gene)	-
Chromosome	2
Chromosome location	2p13.1

1

miRTarBase ID	miRNA	Experiments	Reference
MIRT046253	hsa-miR-23b-3p	CLASH	23622248

17 Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002091	Process	Negative regulation of receptor internalization	IMP	30458214
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0007338	Process	Single fertilization	IEA
GO:0007338	Process	Single fertilization	ISS
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IEA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	ISS
GO:0016020	Component	Membrane	IEA
GO:0031514	Component	Motile cilium	IBA
GO:0031982	Component	Vesicle	IDA	30458214
GO:0031982	Component	Vesicle	IEA
GO:0042058	Process	Regulation of epidermal growth factor receptor signaling pathway	IDA	30458214
GO:0042803	Function	Protein homodimerization activity	IDA	30458214
GO:0043408	Process	Regulation of MAPK cascade	IMP	30458214

MIM	HGNC	e!Ensembl
620826	25770	ENSG00000005448

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q9H977
Protein name	WD repeat-containing protein 54
Protein function	Plays a role in the adhesion and fusion of the sperm-oocyte membrane through its interactions with IZUMO1 and IZUMO1R/JUNO (By similarity). When cross-linked to form dimers and trimers, it has a regulatory effect on ERK signaling pathway activit
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Expressed in epithelial cells (at protein level) (PubMed:29987896). Isoform 3 expression is highly increased in colorectal cancer cells (PubMed:29987896). {ECO:0000269\|PubMed:29987896}.
Sequence	MFRWERSIPLRGSAAALCNNLSVLQLPARNLTYFGVVHGPSAQLLSAAPEGVPLAQRQLH AKEGAGVSPPLITQVHWCVLPFRVLLVLTSHRGIQMYESNGYTMVYWHALDSGDASPVQA VFARGIAASGHFICVGTWSGRVLVFDIPAKGPNIVLSEELAGHQMPITDIATEPAQGQDC VADMVTADDSGLLCVWRSGPEFTLLTRIPGFGVPCPSVQLWQGIIAAGYGNGQVHLYEAT TGNLHVQINAHARAICALDLASEVGKLLSAGEDTFVHIWKLSRNPESGYIEVEHCHGECV ADTQLCGARFCDSSGNSFAVTGYDLAEIRRFSSV
Sequence length	334
Interactions	View interactions