WDR43 (WD repeat domain 43)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 23160
• Gene name: WD repeat domain 43
• Gene symbol: WDR43
• Synonyms (NCBI Gene): NET12, UTP5
• Chromosome: 2
• Chromosome location: 2p23.2

miRNA Show/Hide all (350)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031487	hsa-miR-16-5p	Proteomics	18668040
MIRT046118	hsa-miR-30b-5p	CLASH	23622248
MIRT037019	hsa-miR-877-3p	CLASH	23622248
MIRT1490569	hsa-miR-1185	CLIP-seq
MIRT1490570	hsa-miR-1207-3p	CLIP-seq
MIRT1490571	hsa-miR-1257	CLIP-seq
MIRT1490572	hsa-miR-128	CLIP-seq
MIRT1490573	hsa-miR-1285	CLIP-seq
MIRT1490574	hsa-miR-1290	CLIP-seq
MIRT1490575	hsa-miR-135a	CLIP-seq
MIRT1490576	hsa-miR-135b	CLIP-seq
MIRT1490577	hsa-miR-136	CLIP-seq
MIRT1490578	hsa-miR-149	CLIP-seq
MIRT1490579	hsa-miR-1827	CLIP-seq
MIRT1490580	hsa-miR-197	CLIP-seq
MIRT1490581	hsa-miR-2110	CLIP-seq
MIRT1490582	hsa-miR-223	CLIP-seq
MIRT1490583	hsa-miR-27a	CLIP-seq
MIRT1490584	hsa-miR-27b	CLIP-seq
MIRT1490585	hsa-miR-2964a-5p	CLIP-seq
MIRT1490586	hsa-miR-298	CLIP-seq
MIRT1490587	hsa-miR-3064-5p	CLIP-seq
MIRT1490588	hsa-miR-3119	CLIP-seq
MIRT1490589	hsa-miR-3120-3p	CLIP-seq
MIRT1490590	hsa-miR-3140-3p	CLIP-seq
MIRT1490591	hsa-miR-3143	CLIP-seq
MIRT1490592	hsa-miR-3145-5p	CLIP-seq
MIRT1490593	hsa-miR-3160-3p	CLIP-seq
MIRT1490594	hsa-miR-3160-5p	CLIP-seq
MIRT1490595	hsa-miR-3163	CLIP-seq
MIRT1490596	hsa-miR-3167	CLIP-seq
MIRT1490597	hsa-miR-3187-5p	CLIP-seq
MIRT1490598	hsa-miR-3189-3p	CLIP-seq
MIRT1490599	hsa-miR-340	CLIP-seq
MIRT1490600	hsa-miR-342-5p	CLIP-seq
MIRT1490601	hsa-miR-3605-5p	CLIP-seq
MIRT1490602	hsa-miR-3622b-5p	CLIP-seq
MIRT1490603	hsa-miR-3663-3p	CLIP-seq
MIRT1490604	hsa-miR-3664-3p	CLIP-seq
MIRT1490605	hsa-miR-3665	CLIP-seq
MIRT1490606	hsa-miR-3674	CLIP-seq
MIRT1490607	hsa-miR-3678-3p	CLIP-seq
MIRT1490608	hsa-miR-3679-5p	CLIP-seq
MIRT1490609	hsa-miR-3907	CLIP-seq
MIRT1490610	hsa-miR-3941	CLIP-seq
MIRT1490611	hsa-miR-410	CLIP-seq
MIRT1490612	hsa-miR-412	CLIP-seq
MIRT1490613	hsa-miR-4271	CLIP-seq
MIRT1490614	hsa-miR-4314	CLIP-seq
MIRT1490615	hsa-miR-4324	CLIP-seq
MIRT1490616	hsa-miR-4426	CLIP-seq
MIRT1490617	hsa-miR-4436a	CLIP-seq
MIRT1490618	hsa-miR-4477a	CLIP-seq
MIRT1490619	hsa-miR-450b-3p	CLIP-seq
MIRT1490620	hsa-miR-450b-5p	CLIP-seq
MIRT1490621	hsa-miR-4520a-3p	CLIP-seq
MIRT1490622	hsa-miR-4520b-3p	CLIP-seq
MIRT1490623	hsa-miR-4530	CLIP-seq
MIRT1490624	hsa-miR-4642	CLIP-seq
MIRT1490625	hsa-miR-4647	CLIP-seq
MIRT1490626	hsa-miR-4651	CLIP-seq
MIRT1490627	hsa-miR-4659a-5p	CLIP-seq
MIRT1490628	hsa-miR-4659b-5p	CLIP-seq
MIRT1490629	hsa-miR-466	CLIP-seq
MIRT1490630	hsa-miR-4662b	CLIP-seq
MIRT1490631	hsa-miR-4664-5p	CLIP-seq
MIRT1490632	hsa-miR-4667-5p	CLIP-seq
MIRT1490633	hsa-miR-4672	CLIP-seq
MIRT1490634	hsa-miR-4680-3p	CLIP-seq
MIRT1490635	hsa-miR-4687-5p	CLIP-seq
MIRT1490636	hsa-miR-4697-3p	CLIP-seq
MIRT1490637	hsa-miR-4699-3p	CLIP-seq
MIRT1490638	hsa-miR-4700-5p	CLIP-seq
MIRT1490639	hsa-miR-4711-3p	CLIP-seq
MIRT1490640	hsa-miR-4713-3p	CLIP-seq
MIRT1490641	hsa-miR-4725-3p	CLIP-seq
MIRT1490642	hsa-miR-4729	CLIP-seq
MIRT1490643	hsa-miR-4776-3p	CLIP-seq
MIRT1490644	hsa-miR-4778-3p	CLIP-seq
MIRT1490645	hsa-miR-4778-5p	CLIP-seq
MIRT1490646	hsa-miR-4782-5p	CLIP-seq
MIRT1490647	hsa-miR-4793-5p	CLIP-seq
MIRT1490648	hsa-miR-4794	CLIP-seq
MIRT1490649	hsa-miR-4796-3p	CLIP-seq
MIRT1490650	hsa-miR-4796-5p	CLIP-seq
MIRT1490651	hsa-miR-494	CLIP-seq
MIRT1490652	hsa-miR-518a-5p	CLIP-seq
MIRT1490653	hsa-miR-520g	CLIP-seq
MIRT1490654	hsa-miR-520h	CLIP-seq
MIRT1490655	hsa-miR-527	CLIP-seq
MIRT1490656	hsa-miR-543	CLIP-seq
MIRT1490657	hsa-miR-545	CLIP-seq
MIRT1490658	hsa-miR-548c-3p	CLIP-seq
MIRT1490659	hsa-miR-548n	CLIP-seq
MIRT1490660	hsa-miR-548t	CLIP-seq
MIRT1490661	hsa-miR-608	CLIP-seq
MIRT1490662	hsa-miR-612	CLIP-seq
MIRT1490663	hsa-miR-617	CLIP-seq
MIRT1490664	hsa-miR-633	CLIP-seq
MIRT1490665	hsa-miR-637	CLIP-seq
MIRT1490666	hsa-miR-638	CLIP-seq
MIRT1490667	hsa-miR-646	CLIP-seq
MIRT1490668	hsa-miR-656	CLIP-seq
MIRT1490669	hsa-miR-657	CLIP-seq
MIRT1490670	hsa-miR-760	CLIP-seq
MIRT1490671	hsa-miR-769-3p	CLIP-seq
MIRT1490672	hsa-miR-876-5p	CLIP-seq
MIRT1490573	hsa-miR-1285	CLIP-seq
MIRT1490575	hsa-miR-135a	CLIP-seq
MIRT1490576	hsa-miR-135b	CLIP-seq
MIRT2147906	hsa-miR-145	CLIP-seq
MIRT1490579	hsa-miR-1827	CLIP-seq
MIRT1490580	hsa-miR-197	CLIP-seq
MIRT1490591	hsa-miR-3143	CLIP-seq
MIRT1490592	hsa-miR-3145-5p	CLIP-seq
MIRT1490597	hsa-miR-3187-5p	CLIP-seq
MIRT1490606	hsa-miR-3674	CLIP-seq
MIRT2147907	hsa-miR-3925-3p	CLIP-seq
MIRT1490611	hsa-miR-410	CLIP-seq
MIRT1490624	hsa-miR-4642	CLIP-seq
MIRT2147908	hsa-miR-4686	CLIP-seq
MIRT1490635	hsa-miR-4687-5p	CLIP-seq
MIRT2147909	hsa-miR-4703-3p	CLIP-seq
MIRT1490647	hsa-miR-4793-5p	CLIP-seq
MIRT2147910	hsa-miR-508-5p	CLIP-seq
MIRT1490656	hsa-miR-543	CLIP-seq
MIRT1490662	hsa-miR-612	CLIP-seq
MIRT1490572	hsa-miR-128	CLIP-seq
MIRT2368326	hsa-miR-1284	CLIP-seq
MIRT2368327	hsa-miR-129-3p	CLIP-seq
MIRT1490575	hsa-miR-135a	CLIP-seq
MIRT1490576	hsa-miR-135b	CLIP-seq
MIRT1490577	hsa-miR-136	CLIP-seq
MIRT1490578	hsa-miR-149	CLIP-seq
MIRT2368328	hsa-miR-1913	CLIP-seq
MIRT1490581	hsa-miR-2110	CLIP-seq
MIRT2368329	hsa-miR-2115	CLIP-seq
MIRT2368330	hsa-miR-216b	CLIP-seq
MIRT1490583	hsa-miR-27a	CLIP-seq
MIRT1490584	hsa-miR-27b	CLIP-seq
MIRT1490587	hsa-miR-3064-5p	CLIP-seq
MIRT1490589	hsa-miR-3120-3p	CLIP-seq
MIRT2368331	hsa-miR-3130-3p	CLIP-seq
MIRT1490592	hsa-miR-3145-5p	CLIP-seq
MIRT2368332	hsa-miR-324-3p	CLIP-seq
MIRT1490600	hsa-miR-342-5p	CLIP-seq
MIRT2368333	hsa-miR-345	CLIP-seq
MIRT1490602	hsa-miR-3622b-5p	CLIP-seq
MIRT1490603	hsa-miR-3663-3p	CLIP-seq
MIRT1490604	hsa-miR-3664-3p	CLIP-seq
MIRT1490605	hsa-miR-3665	CLIP-seq
MIRT2368334	hsa-miR-3682-3p	CLIP-seq
MIRT1490609	hsa-miR-3907	CLIP-seq
MIRT1490610	hsa-miR-3941	CLIP-seq
MIRT1490613	hsa-miR-4271	CLIP-seq
MIRT1490614	hsa-miR-4314	CLIP-seq
MIRT2368335	hsa-miR-4325	CLIP-seq
MIRT1490616	hsa-miR-4426	CLIP-seq
MIRT1490617	hsa-miR-4436a	CLIP-seq
MIRT2368336	hsa-miR-4502	CLIP-seq
MIRT1490619	hsa-miR-450b-3p	CLIP-seq
MIRT1490625	hsa-miR-4647	CLIP-seq
MIRT1490626	hsa-miR-4651	CLIP-seq
MIRT1490627	hsa-miR-4659a-5p	CLIP-seq
MIRT1490628	hsa-miR-4659b-5p	CLIP-seq
MIRT1490629	hsa-miR-466	CLIP-seq
MIRT1490630	hsa-miR-4662b	CLIP-seq
MIRT1490631	hsa-miR-4664-5p	CLIP-seq
MIRT1490632	hsa-miR-4667-5p	CLIP-seq
MIRT1490633	hsa-miR-4672	CLIP-seq
MIRT1490637	hsa-miR-4699-3p	CLIP-seq
MIRT1490638	hsa-miR-4700-5p	CLIP-seq
MIRT1490640	hsa-miR-4713-3p	CLIP-seq
MIRT2368337	hsa-miR-4716-5p	CLIP-seq
MIRT2368338	hsa-miR-4719	CLIP-seq
MIRT1490641	hsa-miR-4725-3p	CLIP-seq
MIRT1490642	hsa-miR-4729	CLIP-seq
MIRT2368339	hsa-miR-4762-5p	CLIP-seq
MIRT1490643	hsa-miR-4776-3p	CLIP-seq
MIRT1490645	hsa-miR-4778-5p	CLIP-seq
MIRT2368340	hsa-miR-4789-5p	CLIP-seq
MIRT2368341	hsa-miR-4792	CLIP-seq
MIRT2368342	hsa-miR-4793-3p	CLIP-seq
MIRT1490648	hsa-miR-4794	CLIP-seq
MIRT1490649	hsa-miR-4796-3p	CLIP-seq
MIRT1490653	hsa-miR-520g	CLIP-seq
MIRT1490654	hsa-miR-520h	CLIP-seq
MIRT2368343	hsa-miR-526b	CLIP-seq
MIRT1490657	hsa-miR-545	CLIP-seq
MIRT2368344	hsa-miR-576-5p	CLIP-seq
MIRT1490661	hsa-miR-608	CLIP-seq
MIRT2368345	hsa-miR-616	CLIP-seq
MIRT1490664	hsa-miR-633	CLIP-seq
MIRT1490665	hsa-miR-637	CLIP-seq
MIRT1490666	hsa-miR-638	CLIP-seq
MIRT1490668	hsa-miR-656	CLIP-seq
MIRT1490669	hsa-miR-657	CLIP-seq
MIRT1490670	hsa-miR-760	CLIP-seq
MIRT1490671	hsa-miR-769-3p	CLIP-seq
MIRT2368346	hsa-miR-877	CLIP-seq
MIRT1490572	hsa-miR-128	CLIP-seq
MIRT1490573	hsa-miR-1285	CLIP-seq
MIRT1490579	hsa-miR-1827	CLIP-seq
MIRT1490580	hsa-miR-197	CLIP-seq
MIRT1490583	hsa-miR-27a	CLIP-seq
MIRT1490584	hsa-miR-27b	CLIP-seq
MIRT1490597	hsa-miR-3187-5p	CLIP-seq
MIRT1490635	hsa-miR-4687-5p	CLIP-seq
MIRT2441666	hsa-miR-4761-5p	CLIP-seq
MIRT2368341	hsa-miR-4792	CLIP-seq
MIRT1490662	hsa-miR-612	CLIP-seq
MIRT1490664	hsa-miR-633	CLIP-seq
MIRT1490569	hsa-miR-1185	CLIP-seq
MIRT1490571	hsa-miR-1257	CLIP-seq
MIRT2661944	hsa-miR-1279	CLIP-seq
MIRT1490572	hsa-miR-128	CLIP-seq
MIRT1490573	hsa-miR-1285	CLIP-seq
MIRT1490574	hsa-miR-1290	CLIP-seq
MIRT2661945	hsa-miR-141	CLIP-seq
MIRT2147906	hsa-miR-145	CLIP-seq
MIRT1490579	hsa-miR-1827	CLIP-seq
MIRT2661946	hsa-miR-188-5p	CLIP-seq
MIRT1490580	hsa-miR-197	CLIP-seq
MIRT2661947	hsa-miR-200a	CLIP-seq
MIRT2661948	hsa-miR-205	CLIP-seq
MIRT1490583	hsa-miR-27a	CLIP-seq
MIRT1490584	hsa-miR-27b	CLIP-seq
MIRT2661949	hsa-miR-30a	CLIP-seq
MIRT2661950	hsa-miR-30b	CLIP-seq
MIRT2661951	hsa-miR-30c	CLIP-seq
MIRT2661952	hsa-miR-30d	CLIP-seq
MIRT2661953	hsa-miR-30e	CLIP-seq
MIRT1490589	hsa-miR-3120-3p	CLIP-seq
MIRT1490592	hsa-miR-3145-5p	CLIP-seq
MIRT1490597	hsa-miR-3187-5p	CLIP-seq
MIRT1490598	hsa-miR-3189-3p	CLIP-seq
MIRT1490600	hsa-miR-342-5p	CLIP-seq
MIRT1490601	hsa-miR-3605-5p	CLIP-seq
MIRT1490602	hsa-miR-3622b-5p	CLIP-seq
MIRT2661954	hsa-miR-3647-3p	CLIP-seq
MIRT1490604	hsa-miR-3664-3p	CLIP-seq
MIRT2661955	hsa-miR-3672	CLIP-seq
MIRT1490606	hsa-miR-3674	CLIP-seq
MIRT1490608	hsa-miR-3679-5p	CLIP-seq
MIRT1490609	hsa-miR-3907	CLIP-seq
MIRT2147907	hsa-miR-3925-3p	CLIP-seq
MIRT1490610	hsa-miR-3941	CLIP-seq
MIRT2661956	hsa-miR-3944-5p	CLIP-seq
MIRT2661957	hsa-miR-3978	CLIP-seq
MIRT1490617	hsa-miR-4436a	CLIP-seq
MIRT2661958	hsa-miR-4480	CLIP-seq
MIRT1490619	hsa-miR-450b-3p	CLIP-seq
MIRT1490624	hsa-miR-4642	CLIP-seq
MIRT1490626	hsa-miR-4651	CLIP-seq
MIRT1490629	hsa-miR-466	CLIP-seq
MIRT1490631	hsa-miR-4664-5p	CLIP-seq
MIRT1490632	hsa-miR-4667-5p	CLIP-seq
MIRT1490633	hsa-miR-4672	CLIP-seq
MIRT1490635	hsa-miR-4687-5p	CLIP-seq
MIRT1490637	hsa-miR-4699-3p	CLIP-seq
MIRT1490638	hsa-miR-4700-5p	CLIP-seq
MIRT2147909	hsa-miR-4703-3p	CLIP-seq
MIRT1490640	hsa-miR-4713-3p	CLIP-seq
MIRT2441666	hsa-miR-4761-5p	CLIP-seq
MIRT2368341	hsa-miR-4792	CLIP-seq
MIRT1490647	hsa-miR-4793-5p	CLIP-seq
MIRT1490649	hsa-miR-4796-3p	CLIP-seq
MIRT1490651	hsa-miR-494	CLIP-seq
MIRT2147910	hsa-miR-508-5p	CLIP-seq
MIRT1490653	hsa-miR-520g	CLIP-seq
MIRT1490654	hsa-miR-520h	CLIP-seq
MIRT1490657	hsa-miR-545	CLIP-seq
MIRT2661959	hsa-miR-548ag	CLIP-seq
MIRT2661960	hsa-miR-548ai	CLIP-seq
MIRT2661961	hsa-miR-548m	CLIP-seq
MIRT1490661	hsa-miR-608	CLIP-seq
MIRT1490662	hsa-miR-612	CLIP-seq
MIRT1490664	hsa-miR-633	CLIP-seq
MIRT1490665	hsa-miR-637	CLIP-seq
MIRT1490666	hsa-miR-638	CLIP-seq
MIRT1490671	hsa-miR-769-3p	CLIP-seq
MIRT1490569	hsa-miR-1185	CLIP-seq
MIRT1490571	hsa-miR-1257	CLIP-seq
MIRT2661944	hsa-miR-1279	CLIP-seq
MIRT1490572	hsa-miR-128	CLIP-seq
MIRT1490573	hsa-miR-1285	CLIP-seq
MIRT1490574	hsa-miR-1290	CLIP-seq
MIRT2661945	hsa-miR-141	CLIP-seq
MIRT2147906	hsa-miR-145	CLIP-seq
MIRT1490579	hsa-miR-1827	CLIP-seq
MIRT2661946	hsa-miR-188-5p	CLIP-seq
MIRT1490580	hsa-miR-197	CLIP-seq
MIRT2661947	hsa-miR-200a	CLIP-seq
MIRT2661948	hsa-miR-205	CLIP-seq
MIRT1490583	hsa-miR-27a	CLIP-seq
MIRT1490584	hsa-miR-27b	CLIP-seq
MIRT2661949	hsa-miR-30a	CLIP-seq
MIRT2661950	hsa-miR-30b	CLIP-seq
MIRT2661951	hsa-miR-30c	CLIP-seq
MIRT2661952	hsa-miR-30d	CLIP-seq
MIRT2661953	hsa-miR-30e	CLIP-seq
MIRT1490589	hsa-miR-3120-3p	CLIP-seq
MIRT1490592	hsa-miR-3145-5p	CLIP-seq
MIRT1490597	hsa-miR-3187-5p	CLIP-seq
MIRT1490598	hsa-miR-3189-3p	CLIP-seq
MIRT1490600	hsa-miR-342-5p	CLIP-seq
MIRT1490601	hsa-miR-3605-5p	CLIP-seq
MIRT1490602	hsa-miR-3622b-5p	CLIP-seq
MIRT2661954	hsa-miR-3647-3p	CLIP-seq
MIRT1490604	hsa-miR-3664-3p	CLIP-seq
MIRT2661955	hsa-miR-3672	CLIP-seq
MIRT1490606	hsa-miR-3674	CLIP-seq
MIRT1490608	hsa-miR-3679-5p	CLIP-seq
MIRT1490609	hsa-miR-3907	CLIP-seq
MIRT2147907	hsa-miR-3925-3p	CLIP-seq
MIRT1490610	hsa-miR-3941	CLIP-seq
MIRT2661956	hsa-miR-3944-5p	CLIP-seq
MIRT2661957	hsa-miR-3978	CLIP-seq
MIRT1490617	hsa-miR-4436a	CLIP-seq
MIRT2661958	hsa-miR-4480	CLIP-seq
MIRT1490619	hsa-miR-450b-3p	CLIP-seq
MIRT1490624	hsa-miR-4642	CLIP-seq
MIRT1490626	hsa-miR-4651	CLIP-seq
MIRT1490629	hsa-miR-466	CLIP-seq
MIRT1490631	hsa-miR-4664-5p	CLIP-seq
MIRT1490632	hsa-miR-4667-5p	CLIP-seq
MIRT1490633	hsa-miR-4672	CLIP-seq
MIRT1490635	hsa-miR-4687-5p	CLIP-seq
MIRT1490637	hsa-miR-4699-3p	CLIP-seq
MIRT1490638	hsa-miR-4700-5p	CLIP-seq
MIRT2147909	hsa-miR-4703-3p	CLIP-seq
MIRT1490640	hsa-miR-4713-3p	CLIP-seq
MIRT2441666	hsa-miR-4761-5p	CLIP-seq
MIRT2368341	hsa-miR-4792	CLIP-seq
MIRT1490647	hsa-miR-4793-5p	CLIP-seq
MIRT1490649	hsa-miR-4796-3p	CLIP-seq
MIRT1490651	hsa-miR-494	CLIP-seq
MIRT2147910	hsa-miR-508-5p	CLIP-seq
MIRT1490653	hsa-miR-520g	CLIP-seq
MIRT1490654	hsa-miR-520h	CLIP-seq
MIRT1490657	hsa-miR-545	CLIP-seq
MIRT2661959	hsa-miR-548ag	CLIP-seq
MIRT2661960	hsa-miR-548ai	CLIP-seq
MIRT2661961	hsa-miR-548m	CLIP-seq
MIRT1490661	hsa-miR-608	CLIP-seq
MIRT1490662	hsa-miR-612	CLIP-seq
MIRT1490664	hsa-miR-633	CLIP-seq
MIRT1490665	hsa-miR-637	CLIP-seq
MIRT1490666	hsa-miR-638	CLIP-seq
MIRT1490671	hsa-miR-769-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000462	Process	Maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISS
GO:0000993	Function	RNA polymerase II complex binding	IEA
GO:0000993	Function	RNA polymerase II complex binding	ISS
GO:0001650	Component	Fibrillar center	IDA	24219289
GO:0001650	Component	Fibrillar center	IEA
GO:0003711	Function	Transcription elongation factor activity	IEA
GO:0003711	Function	Transcription elongation factor activity	ISS
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	22916032, 24219289, 28514442, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	17699751, 24219289
GO:0005730	Component	Nucleolus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006364	Process	RRNA processing	IEA
GO:0032040	Component	Small-subunit processome	IDA	34516797
GO:0034243	Process	Regulation of transcription elongation by RNA polymerase II	IEA
GO:0034243	Process	Regulation of transcription elongation by RNA polymerase II	ISS
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0042274	Process	Ribosomal small subunit biogenesis	IDA	34516797
GO:0045943	Process	Positive regulation of transcription by RNA polymerase I	IMP	17699751
GO:2000036	Process	Regulation of stem cell population maintenance	IEA
GO:2000036	Process	Regulation of stem cell population maintenance	ISS
GO:2000234	Process	Positive regulation of rRNA processing	IMP	17699751

Other IDs

• MIM: 616195
• HGNC: 28945
• e!Ensembl: ENSG00000163811

Protein

• UniProt ID: Q15061
• Protein name: WD repeat-containing protein 43 (U3 small nucleolar RNA-associated protein 5 homolog)
• Protein function: Ribosome biogenesis factor that coordinates hyperactive transcription and ribogenesis (PubMed:17699751). Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU proces
• PDB: 7MQ8 , 7MQ9 , 7MQA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00400	WD40	115 → 154	WD domain, G-beta repeat	Repeat
  PF00400	WD40	157 → 194	WD domain, G-beta repeat	Repeat
  PF04003	Utp12	473 → 577	Dip2/Utp12 Family	Family

• Sequence:

  MAAGGGGSCDPLAPAGVPCAFSPHSQAYFALASTDGHLRVWETANNRLHQEYVPSAHLSG
  TCTCLAWAPARLQAKESPQRKKRKSEAVGMSNQTDLLALGTAVGSILLYSTVKGELHSKL
  ISGGHDNRVNCIQWHQDSGCLYSCSDDKHIVEWNVQTCKVKCKWKGDNSSVSSLCISPDG
  KMLLSAGRTIKLWVLETKEVYRHFTGHATPVSSLMFTTIRPPNESQPFDGITGLYFLSGA
  VHDRLLNVWQVRSENKEKSAVMSFTVTDEPVYIDLTLSENKEEPVKLAVVCRDGQVHLFE
  HILNGYCKKPLTSNCTIQIATPGKGKKSTPKPIPILAAGFCSDKMSLLLVYGSWFQPTIE
  RVALNSREPHMCLVRDISNCWAPKVETAITKVRTPVMNSEAKVLVPGIPGHHAAIKPAPP
  QTEQVESKRKSGGNEVSIEERLGAMDIDTHKKGKEDLQTNSFPVLLTQGLESNDFEMLNK
  VLQTRNVNLIKKTVLRMPLHTIIPLLQELTKRLQGHPNSAVLMVQWLKCVLTVHASYLST
  LPDLVPQLGTLYQLMESRVKTFQKLSHLHGKLILLITQVTASEKTKGATSPGQKAKLVYE
  EESSEEESDDEIADKDSEDNWDEDEEESESEKDEDVEEEDEDAEGKDEENGEDRDTASEK
  ELNGDSDLDPENESEEE

• Sequence length: 677

Pathways

KEGG Pathway:

Ribosome biogenesis in eukaryotes

Reactome Pathway:

Major pathway of rRNA processing in the nucleolus and cytosol

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (14)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	27117709	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	27117709, 29058716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	27117709, 29058716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUMINAL A BREAST CARCINOMA	—	GWAS catalog	38832928	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIPLE-NEGATIVE BREAST CANCER	—	GWAS catalog	38832928	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (6)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	27117709		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	27117709, 34803163	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29658574	Associate	★☆☆☆☆ Found in Text Mining only
Mandibulofacial Dysostosis	Mandibulofacial Dysostosis	BEFREE	24497835		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	38110868	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	39438952	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

POGLUT3 2 shared diseasesEstrogen-receptor negative breast cancer, Triple negative breast cancer 2 shared evidence sourcesGWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Triple negative breast cancer) Related via 2 shared diseases including Estrogen-receptor negative breast cancer, Triple negative breast cancer — evidence mostly GWAS catalog. ABHD8 2 shared diseasesEstrogen-receptor negative breast cancer, Triple negative breast cancer 2 shared evidence sourcesGWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Triple negative breast cancer) Related via 2 shared diseases including Estrogen-receptor negative breast cancer, Triple negative breast cancer — evidence mostly GWAS catalog. ANKLE1 2 shared diseasesEstrogen-receptor negative breast cancer, Triple negative breast cancer 2 shared evidence sourcesGWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Triple negative breast cancer) Related via 2 shared diseases including Estrogen-receptor negative breast cancer, Triple negative breast cancer — evidence mostly GWAS catalog. RCL1 2 shared pathwaysRibosome biogenesis in eukaryotes, Major pathway of rRNA processing in the nucleolus and cytosol Related via 2 shared pathways including Ribosome biogenesis in eukaryotes, Major pathway of rRNA processing in the nucleolus and cytosol. MPHOSPH10 2 shared pathwaysRibosome biogenesis in eukaryotes, Major pathway of rRNA processing in the nucleolus and cytosol Related via 2 shared pathways including Ribosome biogenesis in eukaryotes, Major pathway of rRNA processing in the nucleolus and cytosol.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
POGLUT3	2	["Estrogen-receptor negative breast cancer","Triple negative breast cancer"]	0	[]	2	["GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Triple negative breast cancer)"]
ABHD8	2	["Estrogen-receptor negative breast cancer","Triple negative breast cancer"]	0	[]	2	["GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Triple negative breast cancer)"]
ANKLE1	2	["Estrogen-receptor negative breast cancer","Triple negative breast cancer"]	0	[]	2	["GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Triple negative breast cancer)"]
RCL1	0	[]	2	["Ribosome biogenesis in eukaryotes","Major pathway of rRNA processing in the nucleolus and cytosol"]	0	[]
MPHOSPH10	0	[]	2	["Ribosome biogenesis in eukaryotes","Major pathway of rRNA processing in the nucleolus and cytosol"]	0	[]

Diseases Linked via Similar Genes

Basal cell carcinoma Linked via 2 of 5 related genesABHD8, ANKLE1 Essential tremor Linked via 2 of 5 related genesABHD8, ANKLE1 Ovarian cancer Linked via 2 of 5 related genesABHD8, ANKLE1 Squamous cell carcinoma Linked via 2 of 5 related genesABHD8, ANKLE1 Upper aerodigestive tract neoplasm Linked via 2 of 5 related genesABHD8, ANKLE1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Basal cell carcinoma	2	["ABHD8","ANKLE1"]
Essential tremor	2	["ABHD8","ANKLE1"]
Ovarian cancer	2	["ABHD8","ANKLE1"]
Squamous cell carcinoma	2	["ABHD8","ANKLE1"]
Upper aerodigestive tract neoplasm	2	["ABHD8","ANKLE1"]