WDR38 (WD repeat domain 38)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 401551
Gene name WD repeat domain 38
Gene symbol WDR38
Synonyms (NCBI Gene)
-
Chromosome 9
Chromosome location 9q33.3
miRNA miRNA information provided by mirtarbase database.
16 Show/Hide all (16)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1490498 hsa-miR-1287 CLIP-seq
MIRT1490499 hsa-miR-3135b CLIP-seq
MIRT1490500 hsa-miR-3187-3p CLIP-seq
MIRT1490501 hsa-miR-4450 CLIP-seq
MIRT1490502 hsa-miR-4529-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002244 Process Hematopoietic progenitor cell differentiation IEA
GO:1990234 Component Transferase complex IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5JTN6
Protein name WD repeat-containing protein 38
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 95 → 133 WD domain, G-beta repeat Repeat
PF00400 WD40 53 → 91 WD domain, G-beta repeat Repeat
PF00400 WD40 223 → 261 WD domain, G-beta repeat Repeat
PF00400 WD40 183 → 219 WD domain, G-beta repeat Repeat
PF00400 WD40 137 → 175 WD domain, G-beta repeat Repeat
PF00400 WD40 12 → 49 WD domain, G-beta repeat Repeat
Sequence 
MNSGVPATLAVRRVKFFGQHGGEVNSSAFSPDGQMLLTGSEDGCVYGWETRSGQLLWRLG
GHTGPVKFCRFSPDGHLFASASCDCTVRLWDVARAKCLRVLKGHQRSVETVSFSPDSRQL
ASGGWDKRVMLWDVQSGQMLRLLVGHRDSIQSSDFSPTVNCLATGSWDSTVHIWDLRMVT
PAVSHQALEGHSANISCLCYSASGLLASGSWDKTIHIWKPTTSSLLIQLKGHVTWVKSIA
FSPDELWLASAGYSRMVKVWDCNTGKCLETLKGVLDVAHTCAFTPDGKILVSGAADQTRR
QISRTSKSPRDPQT
Sequence length 314
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Lung cancer Uncertain significance ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations

No strongly related genes found yet for WDR38.

No additional diseases found yet through genes similar to WDR38.