WDR18 (WD repeat domain 18)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 57418
• Gene name: WD repeat domain 18
• Gene symbol: WDR18
• Synonyms (NCBI Gene): Ipi3, R32184_1
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com

miRNA Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031424	hsa-miR-16-5p	Proteomics	18668040
MIRT049326	hsa-miR-92a-3p	CLASH	23622248
MIRT039163	hsa-miR-769-5p	CLASH	23622248
MIRT740234	hsa-miR-1972	CLIP-seq
MIRT740235	hsa-miR-24	CLIP-seq
MIRT740246	hsa-miR-3192	CLIP-seq
MIRT740242	hsa-miR-3612	CLIP-seq
MIRT740240	hsa-miR-3622b-5p	CLIP-seq
MIRT740239	hsa-miR-3675-5p	CLIP-seq
MIRT740245	hsa-miR-3689a-3p	CLIP-seq
MIRT740243	hsa-miR-3689c	CLIP-seq
MIRT740237	hsa-miR-4283	CLIP-seq
MIRT740236	hsa-miR-4437	CLIP-seq
MIRT740238	hsa-miR-4489	CLIP-seq
MIRT740233	hsa-miR-4650-5p	CLIP-seq
MIRT740244	hsa-miR-4728-5p	CLIP-seq
MIRT740241	hsa-miR-650	CLIP-seq
MIRT740232	hsa-miR-661	CLIP-seq
MIRT2147702	hsa-miR-4704-3p	CLIP-seq
MIRT2368098	hsa-miR-3150b-3p	CLIP-seq
MIRT2368099	hsa-miR-4689	CLIP-seq
MIRT2368100	hsa-miR-4784	CLIP-seq

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21326211, 28514442, 30021884, 33961781, 34819669, 36351913
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005656	Component	Nuclear pre-replicative complex	IBA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006261	Process	DNA-templated DNA replication	IBA
GO:0006364	Process	RRNA processing	IBA
GO:0120293	Component	Dynein axonemal particle	IEA
GO:0120293	Component	Dynein axonemal particle	ISS
GO:0120330	Component	Rixosome complex	IBA

Other IDs

• MIM: 620291
• HGNC: 17956
• e!Ensembl: ENSG00000065268

Protein

• UniProt ID: Q9BV38
• Protein name: WD repeat-containing protein 18
• Protein function: Functions as a component of the Five Friends of Methylated CHTOP (5FMC) complex; the 5FMC complex is recruited to ZNF148 by methylated CHTOP, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes (PubMed:228728
• PDB: 7UWF , 8FL2 , 8FL3 , 8FL4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00400	WD40	259 → 297	WD domain, G-beta repeat	Repeat
  PF00400	WD40	111 → 149	WD domain, G-beta repeat	Repeat
  PF00400	WD40	163 → 202	WD domain, G-beta repeat	Repeat
  PF14077	WD40_alt	383 → 430	Alternative WD40 repeat motif	Family

• Sequence:

  MAAPMEVAVCTDSAAPMWSCIVWELHSGANLLTYRGGQAGPRGLALLNGEYLLAAQLGKN
  YISAWELQRKDQLQQKIMCPGPVTCLTASPNGLYVLAGVAESIHLWEVSTGNLLVILSRH
  YQDVSCLQFTGDSSHFISGGKDCLVLVWSLCSVLQADPSRIPAPRHVWSHHALPITDLHC
  GFGGPLARVATSSLDQTVKLWEVSSGELLLSVLFDVSIMAVTMDLAEHHMFCGGSEGSIF
  QVDLFTWPGQRERSFHPEQDAGKVFKGHRNQVTCLSVSTDGSVLLSGSHDETVRLWDVQS
  KQCIRTVALKGPVTNAAILLAPVSMLSSDFRPSLPLPHFNKHLLGAEHGDEPRHGGLTLR
  LGLHQQGSEPSYLDRTEQLQAVLCSTMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLF
  DFSTRFITRPAK

• Sequence length: 432

Pathways

Reactome Pathway:

Major pathway of rRNA processing in the nucleolus and cytosol

Related Genes

No strongly related genes found yet for WDR18.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to WDR18.