WASHC1 (WASH complex subunit 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Diseases linked via similar genes

Gene

• Entrez ID: 100287171
• Gene name: WASH complex subunit 1
• Gene symbol: WASHC1
• Synonyms (NCBI Gene): FAM39E, WASH, WASH1
• Chromosome: 9
• Chromosome location: 9p24.3

Gene ontology (GO) Show/Hide all (52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000145	Component	Exocyst	IDA	24344185
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	19922874, 23974797, 24344185, 24643499, 25355947
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IBA
GO:0005769	Component	Early endosome	IDA	19922874
GO:0005769	Component	Early endosome	IEA
GO:0005769	Component	Early endosome	ISS
GO:0005770	Component	Late endosome	IEA
GO:0005776	Component	Autophagosome	IEA
GO:0005776	Component	Autophagosome	ISS
GO:0005814	Component	Centriole	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006887	Process	Exocytosis	IBA
GO:0006887	Process	Exocytosis	IMP	24344185
GO:0010507	Process	Negative regulation of autophagy	ISS
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016197	Process	Endosomal transport	ISS
GO:0016197	Process	Endosomal transport	NAS	19922875
GO:0022617	Process	Extracellular matrix disassembly	IMP	24344185
GO:0030335	Process	Positive regulation of cell migration	IMP	22114305
GO:0031274	Process	Positive regulation of pseudopodium assembly	IMP	22114305
GO:0031396	Process	Regulation of protein ubiquitination	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	23452853
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	NAS	19922874
GO:0032456	Process	Endocytic recycling	IBA
GO:0032456	Process	Endocytic recycling	IMP	22114305
GO:0034314	Process	Arp2/3 complex-mediated actin nucleation	IBA
GO:0034314	Process	Arp2/3 complex-mediated actin nucleation	IDA	23452853
GO:0034314	Process	Arp2/3 complex-mediated actin nucleation	IEA
GO:0034314	Process	Arp2/3 complex-mediated actin nucleation	ISS
GO:0034315	Process	Regulation of Arp2/3 complex-mediated actin nucleation	NAS	19922875
GO:0042147	Process	Retrograde transport, endosome to Golgi	IBA
GO:0042147	Process	Retrograde transport, endosome to Golgi	IDA	23452853
GO:0042147	Process	Retrograde transport, endosome to Golgi	IMP	19922874
GO:0043014	Function	Alpha-tubulin binding	IBA
GO:0043014	Function	Alpha-tubulin binding	IDA	19922874
GO:0043014	Function	Alpha-tubulin binding	IEA
GO:0043015	Function	Gamma-tubulin binding	IBA
GO:0055037	Component	Recycling endosome	IBA
GO:0055037	Component	Recycling endosome	ISS
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0071203	Component	WASH complex	IBA
GO:0071203	Component	WASH complex	IDA	19922875
GO:0071203	Component	WASH complex	IEA
GO:0071203	Component	WASH complex	NAS	19922875
GO:0141039	Function	Phosphatidylinositol 3-kinase inhibitor activity	ISS

Other IDs

• MIM: 613632
• HGNC: 24361
• e!Ensembl: ENSG00000181404

Protein

• UniProt ID: A8K0Z3
• Protein name: WASH complex subunit 1 (CXYorf1-like protein on chromosome 9) (Protein FAM39E) (WAS protein family homolog 1)
• Protein function: Acts as a component of the WASH core complex that functions as a nucleation-promoting factor (NPF) at the surface of endosomes, where it recruits and activates the Arp2/3 complex to induce actin polymerization, playing a key role in the fission
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11945	WASH_WAHD	12 → 300	WAHD domain of WASH complex	Domain

• Sequence:

  MTPVRMQHSLAGQTYAVPFIQPDLRREEAVQQMADALQYLQKVSGDIFSRISQQVEQSRS
  QVQAIGEKVSLAQAKIEKIKGSKKAIKVFSSAKYPAPGRLQEYGSIFTGAQDPGLQRRPR
  HRIQSKHRPLDERALQEKLKDFPVCVSTKPEPEDDAEEGLGGLPSNISSVSSLLLFNTTE
  NLYKKYVFLDPLAGAVTKTHVMLGAETEEKLFDAPLSISKREQLEQQVPENYFYVPDLGQ
  VPEIHVPSYLPDLPGIANDLMYSADLGPGIAPSAPGTIPELPTFHTEVAEPLKVDLQDGV
  LTPPPPPPPPPPAPEVLASAPPLPPSTAAPVGQGARQDDSSSSASPSVQGAPREVVDPSG
  GWATLLESIRQAGGIGKAKLRSMKERKLEKQQQKEQEQVRATSQGGHLMSDLFNKLVMRR
  KGISGKGPGAGEGPGGAFVRVSDSIPPLPPPQQPQAEEDEDDWES

• Sequence length: 465

Pathways

KEGG Pathway:

Endocytosis

Related Genes

No strongly related genes found yet for WASHC1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to WASHC1.