WASH6P (WASP family homolog 6, pseudogene)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 653440
• Gene name: WASP family homolog 6, pseudogene
• Gene symbol: WASH6P
• Synonyms (NCBI Gene): CXYorf1, FAM39A, WASH
• Chromosome: X|Y
• Chromosome location: Xq28 and Yq12

Gene ontology (GO) Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IBA
GO:0005769	Component	Early endosome	IEA
GO:0005769	Component	Early endosome	ISS
GO:0005829	Component	Cytosol	IEA
GO:0006887	Process	Exocytosis	IBA
GO:0016020	Component	Membrane	IEA
GO:0016197	Process	Endosomal transport	ISS
GO:0016197	Process	Endosomal transport	NAS	19922875
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	NAS	19922874
GO:0032456	Process	Endocytic recycling	IBA
GO:0034314	Process	Arp2/3 complex-mediated actin nucleation	IBA
GO:0034314	Process	Arp2/3 complex-mediated actin nucleation	IEA
GO:0034314	Process	Arp2/3 complex-mediated actin nucleation	ISS
GO:0034315	Process	Regulation of Arp2/3 complex-mediated actin nucleation	NAS	19922875
GO:0042147	Process	Retrograde transport, endosome to Golgi	IBA
GO:0042147	Process	Retrograde transport, endosome to Golgi	ISS
GO:0043014	Function	Alpha-tubulin binding	IBA
GO:0043014	Function	Alpha-tubulin binding	IEA
GO:0043014	Function	Alpha-tubulin binding	ISS
GO:0043015	Function	Gamma-tubulin binding	IBA
GO:0055037	Component	Recycling endosome	IBA
GO:0055037	Component	Recycling endosome	ISS
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0071203	Component	WASH complex	IBA
GO:0071203	Component	WASH complex	IEA
GO:0071203	Component	WASH complex	ISS
GO:0071203	Component	WASH complex	NAS	19922875

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: ENSG00000292372

Protein

• UniProt ID: Q9NQA3
• Protein name: WAS protein family homolog 6 (Protein FAM39A)
• Protein function: May act as a nucleation-promoting factor at the surface of endosomes, where it recruits and activates the Arp2/3 complex to induce actin polymerization, playing a key role in the fission of tubules that serve as transport intermediates during en
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11945	WASH_WAHD	34 → 282	WAHD domain of WASH complex	Domain

• Sequence:

  MAFHEMQAHKNALGTSGEQQAADITGPTPHQGGWKQVEQSRSQVQAIGEKVSLAQAKIEK
  IKGSKKAIKVFSSAKYPAPERLQEYGSIFTGAQDPGLQRRPRHRIQSKHRPLDERALQEK
  LKDFPVCVSTKPEPEDDAEEGLGGLPSNISSVSSLLLFNTTENLYKKYVFLDPLAGAVTK
  THVMLGAETEEKLFDAPLSISKREQLEQQVPENYFYVPDLGQVPEIDVPSYLPDLPSIAN
  DLMYSADLGPGIAPSAPGTIPELPTFHTEVAEPLKADLQDGVLTPPPPPPPPPPAPEVLA
  SAPPLPPSTAAPVGQGARQDDGSSSASPSVQGAPREVVDPSGGWATLLESIRQAGGIGKA
  KLRSMKERKLEKKKQKEQEQVRATSQGGHLMSDLFNKLVMRRKGISGKGPGAGEGPGGAF
  ARVSDSIPPVPPPQQPQAEEDEDDWES

• Sequence length: 447

Related Genes

No strongly related genes found yet for WASH6P.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to WASH6P.