WASH3P (WASP family homolog 3, pseudogene)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 374666
• Gene name: WASP family homolog 3, pseudogene
• Gene symbol: WASH3P
• Synonyms (NCBI Gene): FAM39DP
• Chromosome: 15
• Chromosome location: 15q26.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT047160	hsa-miR-183-5p	CLASH	23622248
MIRT045560	hsa-miR-149-5p	CLASH	23622248
MIRT043400	hsa-miR-331-3p	CLASH	23622248
MIRT038874	hsa-miR-93-3p	CLASH	23622248

Gene ontology (GO) Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IBA
GO:0005769	Component	Early endosome	IDA	20175130
GO:0005769	Component	Early endosome	IEA
GO:0005769	Component	Early endosome	ISS
GO:0005776	Component	Autophagosome	IEA
GO:0005814	Component	Centriole	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006622	Process	Protein targeting to lysosome	IMP	20175130
GO:0006887	Process	Exocytosis	IBA
GO:0007032	Process	Endosome organization	IMP	20175130
GO:0016020	Component	Membrane	IEA
GO:0016197	Process	Endosomal transport	ISS
GO:0016197	Process	Endosomal transport	NAS	19922875
GO:0030027	Component	Lamellipodium	IDA	18159949
GO:0030027	Component	Lamellipodium	IEA
GO:0030175	Component	Filopodium	IDA	18159949
GO:0030175	Component	Filopodium	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	NAS	19922874
GO:0032456	Process	Endocytic recycling	IBA
GO:0034314	Process	Arp2/3 complex-mediated actin nucleation	IBA
GO:0034314	Process	Arp2/3 complex-mediated actin nucleation	IDA	18159949
GO:0034314	Process	Arp2/3 complex-mediated actin nucleation	IEA
GO:0034315	Process	Regulation of Arp2/3 complex-mediated actin nucleation	NAS	19922875
GO:0042147	Process	Retrograde transport, endosome to Golgi	IBA
GO:0042147	Process	Retrograde transport, endosome to Golgi	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043014	Function	Alpha-tubulin binding	IBA
GO:0043014	Function	Alpha-tubulin binding	IEA
GO:0043014	Function	Alpha-tubulin binding	ISS
GO:0043015	Function	Gamma-tubulin binding	IBA
GO:0045022	Process	Early endosome to late endosome transport	IMP	20175130
GO:0055037	Component	Recycling endosome	IBA
GO:0055037	Component	Recycling endosome	IDA	20175130
GO:0055037	Component	Recycling endosome	ISS
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0071203	Component	WASH complex	IBA
GO:0071203	Component	WASH complex	IEA
GO:0071203	Component	WASH complex	ISS
GO:0071203	Component	WASH complex	NAS	19922875

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: C4AMC7
• Protein name: Putative WAS protein family homolog 3 (Protein FAM39DP)
• Protein function: Acts as a nucleation-promoting factor at the surface of endosomes, where it recruits and activates the Arp2/3 complex to induce actin polymerization, playing a key role in the fission of tubules that serve as transport intermediates during endos
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11945	WASH_WAHD	12 → 298	WAHD domain of WASH complex	Domain

• Sequence:

  MTPVRMQHSLAGQTYAVPLIQPDLRREEAVQQMADALQYLQKVSGDIFSRISQQVEQSRS
  QVQAIGEKVSLAQAKIEKIKGSKKAIKVFSSAKYPAPERLQEYGSIFTGAQDPGLQRRPR
  HRIQSKHRPLDERALQEKDFPVCVSTKPEPEDDAEEGLGGLPSNISSVSSLLLFNTTENL
  GKKYVFLDPLAGAVTKTHVMLGAETEEKLFDAPLSISKREQLEQQVPENYFYVPDLGQVP
  EIDVPSYLPDLPGITNDLMYIADLGPGIAPSAPGTIPELPTFHTEVAEPLKVDLQDGVLT
  PPPPPPPPPPAPEVLASAPPLPPSTAAPVGQGARQDDSSSSASPSVQGAPREVVDPSGGR
  ATLLESIRQAGGIGKAKLRSMKERKLEKKQQKEQEQVRATSQGGHLMSDLFNKLVMRRKG
  ISGKGPGAGEGPGGAFARVSDSIPPLPPPQQPQAEEDEDDWES

• Sequence length: 463

Related Genes

No strongly related genes found yet for WASH3P.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to WASH3P.