WASF1 (WASP family member 1)

Gene

• Entrez ID: 8936
• Gene name: WASP family member 1
• Gene symbol: WASF1
• Synonyms (NCBI Gene): NEDALVS, SCAR1, WAVE, WAVE-1, WAVE1
• Chromosome: 6
• Chromosome location: 6q21
• Summary: The protein encoded by this gene, a member of the Wiskott-Aldrich syndrome protein (WASP)-family, plays a critical role downstream of Rac, a Rho-family small GTPase, in regulating the actin cytoskeleton required for membrane ruffling. It has been shown to

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs778229060	T>A,C,G	Likely-pathogenic	Missense variant, stop gained, coding sequence variant
rs1562159088	G>A	Pathogenic	Coding sequence variant, stop gained
rs1562159562	G>A	Pathogenic	Coding sequence variant, stop gained
rs1562159599	G>CCTGGC	Pathogenic	Coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023340	hsa-miR-122-5p	Microarray	17612493
MIRT052008	hsa-let-7b-5p	CLASH	23622248
MIRT565012	hsa-miR-4694-3p	PAR-CLIP	20371350
MIRT565009	hsa-miR-411-5p	PAR-CLIP	20371350
MIRT565011	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT565010	hsa-miR-5093	PAR-CLIP	20371350
MIRT565009	hsa-miR-411-5p	PAR-CLIP	20371350
MIRT565008	hsa-miR-6505-5p	PAR-CLIP	20371350
MIRT565012	hsa-miR-4694-3p	PAR-CLIP	20371350
MIRT565009	hsa-miR-411-5p	PAR-CLIP	20371350
MIRT565011	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT565010	hsa-miR-5093	PAR-CLIP	20371350
MIRT565009	hsa-miR-411-5p	PAR-CLIP	20371350
MIRT565008	hsa-miR-6505-5p	PAR-CLIP	20371350
MIRT1488640	hsa-miR-140-5p	CLIP-seq
MIRT1488641	hsa-miR-200b	CLIP-seq
MIRT1488642	hsa-miR-200c	CLIP-seq
MIRT1488643	hsa-miR-299-5p	CLIP-seq
MIRT1488644	hsa-miR-3127-5p	CLIP-seq
MIRT1488645	hsa-miR-338-5p	CLIP-seq
MIRT1488646	hsa-miR-3545-5p	CLIP-seq
MIRT1488647	hsa-miR-374c	CLIP-seq
MIRT1488648	hsa-miR-377	CLIP-seq
MIRT1488649	hsa-miR-410	CLIP-seq
MIRT1488650	hsa-miR-429	CLIP-seq
MIRT1488651	hsa-miR-4460	CLIP-seq
MIRT1488652	hsa-miR-4474-5p	CLIP-seq
MIRT1488653	hsa-miR-4704-5p	CLIP-seq
MIRT1488654	hsa-miR-4720-3p	CLIP-seq
MIRT1488655	hsa-miR-4727-3p	CLIP-seq
MIRT1488656	hsa-miR-4804-3p	CLIP-seq
MIRT1488657	hsa-miR-548p	CLIP-seq
MIRT1488658	hsa-miR-655	CLIP-seq
MIRT1488659	hsa-miR-1305	CLIP-seq
MIRT1488660	hsa-miR-29a	CLIP-seq
MIRT1488661	hsa-miR-29b	CLIP-seq
MIRT1488662	hsa-miR-29c	CLIP-seq
MIRT1488663	hsa-miR-3659	CLIP-seq
MIRT1488664	hsa-miR-3922-5p	CLIP-seq
MIRT1488665	hsa-miR-4303	CLIP-seq
MIRT1488666	hsa-miR-4658	CLIP-seq
MIRT1488667	hsa-miR-4682	CLIP-seq
MIRT1488668	hsa-miR-4762-3p	CLIP-seq
MIRT1488669	hsa-miR-498	CLIP-seq
MIRT1488670	hsa-miR-574-5p	CLIP-seq
MIRT1488671	hsa-miR-630	CLIP-seq
MIRT1488663	hsa-miR-3659	CLIP-seq
MIRT1488665	hsa-miR-4303	CLIP-seq
MIRT1488666	hsa-miR-4658	CLIP-seq
MIRT1488667	hsa-miR-4682	CLIP-seq
MIRT1488668	hsa-miR-4762-3p	CLIP-seq
MIRT1488670	hsa-miR-574-5p	CLIP-seq
MIRT1488671	hsa-miR-630	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	9843499, 11130076, 24439377, 25416956, 28514442, 32296183, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	TAS	10970852
GO:0005925	Component	Focal adhesion	IEA
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0006898	Process	Receptor-mediated endocytosis	ISS
GO:0007005	Process	Mitochondrion organization	IMP	29961568
GO:0015629	Component	Actin cytoskeleton	TAS	9843499
GO:0016601	Process	Rac protein signal transduction	IMP	21107423
GO:0030027	Component	Lamellipodium	IBA
GO:0030027	Component	Lamellipodium	IEA
GO:0030036	Process	Actin cytoskeleton organization	IBA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	IMP	29961568
GO:0030041	Process	Actin filament polymerization	TAS	9843499
GO:0031175	Process	Neuron projection development	IEA
GO:0031209	Component	SCAR complex	IBA
GO:0031209	Component	SCAR complex	IMP	21107423
GO:0031267	Function	Small GTPase binding	IMP	21107423
GO:0032839	Component	Dendrite cytoplasm	IEA
GO:0032991	Component	Protein-containing complex	IDA	25097019
GO:0034237	Function	Protein kinase A regulatory subunit binding	IBA
GO:0045202	Component	Synapse	IEA
GO:0051018	Function	Protein kinase A binding	IPI	25097019
GO:0051388	Process	Positive regulation of neurotrophin TRK receptor signaling pathway	IEA
GO:0065003	Process	Protein-containing complex assembly	NAS	10381382
GO:0070161	Component	Anchoring junction	IEA
GO:0071933	Function	Arp2/3 complex binding	IBA
GO:0072673	Process	Lamellipodium morphogenesis	IEA
GO:0072673	Process	Lamellipodium morphogenesis	IMP	29961568
GO:0097484	Process	Dendrite extension	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098885	Process	Modification of postsynaptic actin cytoskeleton	IEA
GO:0098939	Process	Dendritic transport of mitochondrion	IEA
GO:1990416	Process	Cellular response to brain-derived neurotrophic factor stimulus	IEA
GO:1990416	Process	Cellular response to brain-derived neurotrophic factor stimulus	ISS
GO:2000601	Process	Positive regulation of Arp2/3 complex-mediated actin nucleation	IBA
GO:2000601	Process	Positive regulation of Arp2/3 complex-mediated actin nucleation	IMP	21107423

Other IDs

• MIM: 605035
• HGNC: 12732
• e!Ensembl: ENSG00000112290

Protein

• UniProt ID: Q92558
• Protein name: Actin-binding protein WASF1 (Protein WAVE-1) (Verprolin homology domain-containing protein 1) (Wiskott-Aldrich syndrome protein family member 1) (WASP family protein member 1)
• Protein function: Downstream effector molecule involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. Promotes formation of actin filaments. Part of the WAVE complex that regulates lamellipodia formatio
• PDB: 3P8C, 4N78, 7USC, 7USD, 7USE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02205	WH2	494 → 521	WH2 motif	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in brain. Lowly expressed in testis, ovary, colon, kidney, pancreas, thymus, small intestine and peripheral blood.
• Sequence:

  MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAH
  SFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIP
  LQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQK
  QKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQ
  TYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCISSA
  TGLIENRPQSPATGRTPVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPPA
  TALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEV
  QGLPPPPPPPPLPPPGIRPSSPVTVTALAHPPSGLHPTPSTAPGPHVPLMPPSPPSQVIP
  ASEPKRHPSTLPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSRRIA
  VEYSDSEDDSEFDEVDWLE

• Sequence length: 559

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Epileptic encephalopathy	Pathogenic	rs1562159088	RCV001003962	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual disability	Pathogenic; Likely pathogenic	rs1562159088, rs1562159562, rs1562159599, rs778229060	RCV000681443 RCV000681442 RCV000681444 RCV000986123	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder with absent language and variable seizures	Likely pathogenic; Pathogenic	rs2114445929, rs2534225978, rs2534240781, rs2534211115, rs1562159088, rs1562159562, rs1562159599	RCV001839136 RCV003236527 RCV003388877 RCV004595300 RCV000984537 RCV000984536 RCV000984538	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WASF1-related disorder	Likely benign; Uncertain significance; Conflicting classifications of pathogenicity; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WASF1-related neurodevelopmental disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abetalipoproteinemia	Abetalipoproteinemia	BEFREE	28087633		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	572495		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28103522, 29171012, 30841784		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	27137742, 28103522, 29154170, 29171012, 30841784, 30852375		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29035103		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30841531		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29656278		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	27431690, 28675949, 31750692		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	28281572	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28281572		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	29961568, 30664714		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	29961568	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	18484081		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	15670045	Associate	★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	27322577		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18509249, 26867158, 31068575		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11889456		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26662304	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23680521, 26662304		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28640965, 28712421, 28747248, 29595710, 29925336		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30841531		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23528430		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31812280		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30947822		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	29508385		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	30826160		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	26206446, 28521620, 28712421, 30032060, 30406670, 30852375		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19851300, 29035103		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19851300, 29035103		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	26845255, 31429983		★☆☆☆☆ Found in Text Mining only
Epileptic encephalopathy	Epileptic encephalopathy	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23680521, 26662304		★☆☆☆☆ Found in Text Mining only
Fasciitis, Plantar	Plantar fasciitis	BEFREE	29202989		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	25432536		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29746974		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31812280		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	19890377	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	28700939		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	19851300		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19851300		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	29593570		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	17215396, 28639298, 29961568, 30664714		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	29961568		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Intellectual developmental disorder	Pubtator	29961568	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Leukemia	Leukemia	Pubtator	19890377	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21281239		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31068575		★☆☆☆☆ Found in Text Mining only
Macular retinal edema	Macular edema	BEFREE	29699979		★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	27137742, 30085438		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	29595710, 30616128		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	18509249, 26867158, 31068575		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11889456		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30353690		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18710763, 25906751, 31530281		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18710763, 24969695, 28060584, 29847223, 30675695, 31068575		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	26206446, 28521620, 30032060, 30406670, 30852375		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	27137742, 27988331, 30406670		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	17215396		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	23758647		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29746974		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15750927, 18594528, 25906751, 26662304, 31068575, 31530281		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30826160		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	19738042		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	Pubtator	19738042	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19851300		★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	30147856	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	30974236		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	30041446		★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	26634693		★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	26634693		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	22608885		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28103407, 29172589, 31546045		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	29508385		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	10498630		★☆☆☆☆ Found in Text Mining only
Profound Mental Retardation	Mental retardation	BEFREE	29961568		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18710763, 25906751, 31530281		★☆☆☆☆ Found in Text Mining only
Renal carnitine transport defect	Renal Carnitine Transport Defect	BEFREE	28463803		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	30841531		★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	29664983, 29699979		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	20956521		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	20956521	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28549722		★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	26928377		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	29961568	Associate	★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA, AUTOSOMAL RECESSIVE 1	Spinocerebellar Ataxia	BEFREE	23786967		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30697796		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29129256		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	29420626	Associate	★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	26928377		★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	12632375		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	12632375		★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	LHGDN	12429845, 18995840		★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	18710763		★☆☆☆☆ Found in Text Mining only