VSIG8 (V-set and immunoglobulin domain containing 8)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 391123
Gene name V-set and immunoglobulin domain containing 8
Gene symbol VSIG8
Synonyms (NCBI Gene)
-
Chromosome 1
Chromosome location 1q23.2
miRNA miRNA information provided by mirtarbase database.
7 Show/Hide all (7)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1487859 hsa-miR-361-3p CLIP-seq
MIRT1487860 hsa-miR-885-3p CLIP-seq
MIRT1921509 hsa-miR-1470 CLIP-seq
MIRT1921510 hsa-miR-4469 CLIP-seq
MIRT1921511 hsa-miR-4667-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22681889
GO:0005515 Function Protein binding IPI 28514442, 33961781
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
621098 32063 ENSG00000243284
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DPA2
Protein name V-set and immunoglobulin domain-containing protein 8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 27 → 143 Immunoglobulin V-set domain Domain
PF13927 Ig_3 146 → 243 Domain
Sequence 
MRVGGAFHLLLVCLSPALLSAVRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDI
EWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSD
TATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKW
AKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCT
VANNVGYSVCVVEVKVSDSRRIGVIIGIVLGSLLALGCLAVGIWGLVCCCCGGSGAGGAR
GAFGYGNGGGVGGGACGDLASEIREDAVAPGCKASGRGSRVTHLLGYPTQNVSRSLRRKY
APPPCGGPEDVALAPCTAAAACEAGPSPVYVKVKSAEPADCAEGPVQCKNGLLV
Sequence length 414
Interactions View interactions

No strongly related genes found yet for VSIG8.

No additional diseases found yet through genes similar to VSIG8.