VPREB3 (V-set pre-B cell surrogate light chain 3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 29802
Gene name V-set pre-B cell surrogate light chain 3
Gene symbol VPREB3
Synonyms (NCBI Gene)
8HS20N27C7-2
Chromosome 22
Chromosome location 22q11.23|22q11
Summary The protein encoded by this gene is the human ortholog of the mouse VpreB3 (8HS20) protein, is thought to be involved in B-cell maturation, and may play a role in assembly of the pre-B cell receptor (pre-BCR). While the role of this protein in B-cell deve
miRNA miRNA information provided by mirtarbase database.
11 Show/Hide all (11)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017661 hsa-miR-335-5p Microarray 18185580
MIRT2463260 hsa-miR-3974 CLIP-seq
MIRT2463261 hsa-miR-4475 CLIP-seq
MIRT2463262 hsa-miR-4688 CLIP-seq
MIRT2463263 hsa-miR-486-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005783 Component Endoplasmic reticulum NAS 10702669
GO:0006955 Process Immune response IBA
GO:0019814 Component Immunoglobulin complex IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
605017 12710 ENSG00000128218
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UKI3
Protein name Pre-B lymphocyte protein 3 (N27C7-2) (Protein VPreB3)
Protein function Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 25 → 123 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in B-cell precursors. Expressed in fetal liver, bone marrow, spleen and lymph node.
Sequence 
MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQR
AGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYG
FSP
Sequence length 123
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Cell surface interactions at the vascular wall

No strongly related genes found yet for VPREB3.

No additional diseases found yet through genes similar to VPREB3.