Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	317702
Gene name	Vomeronasal 1 receptor 3
Gene symbol	VN1R3
Synonyms (NCBI Gene)	FKSG46V1RL3V1RL3p
Chromosome	16
Chromosome location	16p11.2

10 Show/Hide all (10)

GO ID	Ontology	Definition	Evidence
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005550	Function	Pheromone binding	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007606	Process	Sensory perception of chemical stimulus	IEA
GO:0016020	Component	Membrane	IEA
GO:0016503	Function	Pheromone receptor activity	IEA
GO:0019236	Process	Response to pheromone	IEA

MIM	HGNC	e!Ensembl
HGNC	19867	N/A

Q9BXE9

Protein name

Vomeronasal type-1 receptor 3 (V1r-like receptor 3)

Protein function

Putative pheromone receptor.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03402	V1R	32 → 292	Vomeronasal organ pheromone receptor family, V1R	Family

Sequence

MASKDFAIGMILLSQIMVGFLGNFFLLYHYSFLCFTRGMLQSTDLILKHLTIANSLVILS
KGIPQTMAAFGLKDSLSDIGCKFVFYVHRVGRAVCVGNACLLSVFQVITISPSEFRWAEL
KLHAHKYIRSFILVLCWILNTLVNITVLLHVTGKWNSINSTKTNDYGYCSGGSRSRIPHS
LHIVLLSSLDVLCLGLMTLASGSMVFILHRHKQQVQHIHGTNLSARSSPESRVTQSILVL
VSTLCYFTRSPPSLHMSLFPNPSWWLLNTSALITACFPMVSPFVLMSRHPRIPRLGSACC
GRNPQFPKLVR

Sequence length

311

Interactions

View interactions

Related Genes Genes most often co-reported with VN1R3 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for VN1R3.

Diseases Linked via Similar Genes Diseases curated for genes most similar to VN1R3 (see Related Genes above), that are NOT already directly curated for VN1R3 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to VN1R3.

VN1R3 (vomeronasal 1 receptor 3)

Bookmark This Gene