VN1R17P (vomeronasal 1 receptor 17 pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 441931
Gene name Vomeronasal 1 receptor 17 pseudogene
Gene symbol VN1R17P
Synonyms (NCBI Gene)
GPCR
Chromosome 1
Chromosome location 1q44
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0005550 Function Pheromone binding IBA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0007165 Process Signal transduction IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 37331 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TDU5
Protein name Putative vomeronasal receptor-like protein 4 (G-protein coupled receptor GPCR23) (hGPCR23)
Protein function Putative pheromone receptor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03402 V1R 38 → 208 Vomeronasal organ pheromone receptor family, V1R Family
Tissue specificity TISSUE SPECIFICITY: Expressed in olfactory nerve. {ECO:0000269|PubMed:12044878}.
Sequence 
MEMTKLFSYIVIKNVYYPQVSFGISANTFLLLFHIFTFAYTHRLKPIDMTISHLPLIHIL
LLFTQAILVSSDLFESWNIQNNDLKCKIITFLNRVMRGVSICTTCLLSVLQAITISPSTS
FLEKFKHISANHTLGFILFSWVLNMFITNNLLLFIVPTPNRIGASLLFVTEHCYVLPMSY
THRSLFFILMVLRDVIFIGLMVLSSGYG
Sequence length 208
Interactions View interactions

No strongly related genes found yet for VN1R17P.

No additional diseases found yet through genes similar to VN1R17P.