VGLL1 (vestigial like family member 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 51442
• Gene name: Vestigial like family member 1
• Gene symbol: VGLL1
• Synonyms (NCBI Gene): TDU, VGL1
• Chromosome: X
• Chromosome location: Xq26.3
• Summary: The protein encoded by this gene binds proteins of the TEA domain family of transcription factors (TEFs) through the Vg (vestigial) homology region found in its N-terminus. It may thus function as a specific coactivator for the mammalian TEFs. [provided b

miRNA Show/Hide all (32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1484284	hsa-miR-1193	CLIP-seq
MIRT1484285	hsa-miR-1290	CLIP-seq
MIRT1484286	hsa-miR-2110	CLIP-seq
MIRT1484287	hsa-miR-27a	CLIP-seq
MIRT1484288	hsa-miR-27b	CLIP-seq
MIRT1484289	hsa-miR-29a	CLIP-seq
MIRT1484290	hsa-miR-29b	CLIP-seq
MIRT1484291	hsa-miR-29c	CLIP-seq
MIRT1484292	hsa-miR-3150a-3p	CLIP-seq
MIRT1484293	hsa-miR-3175	CLIP-seq
MIRT1484294	hsa-miR-3192	CLIP-seq
MIRT1484295	hsa-miR-3613-3p	CLIP-seq
MIRT1484296	hsa-miR-3691-5p	CLIP-seq
MIRT1484297	hsa-miR-3911	CLIP-seq
MIRT1484298	hsa-miR-3941	CLIP-seq
MIRT1484299	hsa-miR-4314	CLIP-seq
MIRT1484300	hsa-miR-4455	CLIP-seq
MIRT1484301	hsa-miR-4646-5p	CLIP-seq
MIRT1484302	hsa-miR-466	CLIP-seq
MIRT1484303	hsa-miR-4672	CLIP-seq
MIRT1484304	hsa-miR-4752	CLIP-seq
MIRT1484305	hsa-miR-4781-5p	CLIP-seq
MIRT1484306	hsa-miR-5096	CLIP-seq
MIRT1484307	hsa-miR-513a-5p	CLIP-seq
MIRT1484308	hsa-miR-548k	CLIP-seq
MIRT1484309	hsa-miR-548n	CLIP-seq
MIRT1484310	hsa-miR-767-5p	CLIP-seq
MIRT1484311	hsa-miR-939	CLIP-seq
MIRT1921333	hsa-miR-3200-5p	CLIP-seq
MIRT1921334	hsa-miR-4303	CLIP-seq
MIRT1921335	hsa-miR-4795-3p	CLIP-seq
MIRT1921336	hsa-miR-664	CLIP-seq

Gene ontology (GO) Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003713	Function	Transcription coactivator activity	TAS	10518497
GO:0005515	Function	Protein binding	IPI	20211142, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	10518497
GO:0005654	Component	Nucleoplasm	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	10518497
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA

Other IDs

• MIM: 300583
• HGNC: 20985
• e!Ensembl: ENSG00000102243

Protein

• UniProt ID: Q99990
• Protein name: Transcription cofactor vestigial-like protein 1 (Vgl-1) (Protein TONDU)
• Protein function: May act as a specific coactivator for the mammalian TEFs.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07545	Vg_Tdu	21 → 51	Vestigial/Tondu family	Family

• Sequence:

  MEEMKKTAIRLPKGKQKPIKTEWNSRCVLFTYFQGDISSVVDEHFSRALSNIKSPQELTP
  SSQSEGVMLKNDDSMSPNQWRYSSPWTKPQPEVPVTNRAANCNLHVPGPMAVNQFSPSLA
  RRASVRPGELWHFSSLAGTSSLEPGYSHPFPARHLVPEPQPDGKREPLLSLLQQDRCLAR
  PQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNETLSELETPGKY
  SLTPPNHWGHPHRYLQHL

• Sequence length: 258

Related Genes

No strongly related genes found yet for VGLL1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to VGLL1.